BLASTX nr result
ID: Akebia23_contig00040405
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00040405 (412 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006487111.1| PREDICTED: pentatricopeptide repeat-containi... 111 9e-23 ref|XP_006423015.1| hypothetical protein CICLE_v10027922mg [Citr... 111 9e-23 ref|XP_003631669.1| PREDICTED: pentatricopeptide repeat-containi... 111 9e-23 emb|CBI32403.3| unnamed protein product [Vitis vinifera] 111 9e-23 emb|CAN64990.1| hypothetical protein VITISV_001772 [Vitis vinifera] 111 9e-23 ref|XP_007031218.1| Pentatricopeptide repeat (PPR) superfamily p... 110 2e-22 ref|XP_006651472.1| PREDICTED: pentatricopeptide repeat-containi... 110 3e-22 ref|XP_003553033.1| PREDICTED: pentatricopeptide repeat-containi... 110 3e-22 ref|XP_004509764.1| PREDICTED: putative pentatricopeptide repeat... 109 3e-22 ref|XP_002277031.2| PREDICTED: pentatricopeptide repeat-containi... 109 3e-22 emb|CBI39641.3| unnamed protein product [Vitis vinifera] 109 3e-22 ref|XP_007138310.1| hypothetical protein PHAVU_009G197900g [Phas... 109 5e-22 ref|XP_004493379.1| PREDICTED: pentatricopeptide repeat-containi... 109 5e-22 ref|XP_007198996.1| hypothetical protein PRUPE_ppa002176mg [Prun... 109 5e-22 ref|XP_002267613.1| PREDICTED: putative pentatricopeptide repeat... 109 5e-22 ref|XP_006578628.1| PREDICTED: pentatricopeptide repeat-containi... 108 6e-22 ref|XP_007042438.1| Tetratricopeptide repeat (TPR)-like superfam... 108 6e-22 ref|XP_004304914.1| PREDICTED: pentatricopeptide repeat-containi... 108 6e-22 ref|XP_003541343.1| PREDICTED: putative pentatricopeptide repeat... 108 6e-22 gb|ABF96424.1| pentatricopeptide, putative [Oryza sativa Japonic... 108 6e-22 >ref|XP_006487111.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Citrus sinensis] Length = 820 Score = 111 bits (278), Expect = 9e-23 Identities = 47/68 (69%), Positives = 53/68 (77%) Frame = -3 Query: 410 SEKLAIAFGHAHIPPNMPIRVMKNLRVCGDCHNWTKFFSKMTRREVIVRDGRRFHHFMDG 231 SE+LAIAFG PP PI++ KNL VCGDCHNWTKF S++T RE+IVRD RFHHF DG Sbjct: 753 SERLAIAFGIISSPPKSPIQIFKNLWVCGDCHNWTKFISQITEREIIVRDSNRFHHFKDG 812 Query: 230 FCSCKDYW 207 CSC DYW Sbjct: 813 ICSCGDYW 820 >ref|XP_006423015.1| hypothetical protein CICLE_v10027922mg [Citrus clementina] gi|557524949|gb|ESR36255.1| hypothetical protein CICLE_v10027922mg [Citrus clementina] Length = 705 Score = 111 bits (278), Expect = 9e-23 Identities = 47/68 (69%), Positives = 53/68 (77%) Frame = -3 Query: 410 SEKLAIAFGHAHIPPNMPIRVMKNLRVCGDCHNWTKFFSKMTRREVIVRDGRRFHHFMDG 231 SE+LAIAFG PP PI++ KNLRVCGDCHNWTKF S++T RE+IVRD RFH F DG Sbjct: 638 SERLAIAFGIISSPPKSPIQIFKNLRVCGDCHNWTKFISQITEREIIVRDSNRFHRFKDG 697 Query: 230 FCSCKDYW 207 CSC DYW Sbjct: 698 ICSCGDYW 705 >ref|XP_003631669.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Vitis vinifera] Length = 891 Score = 111 bits (278), Expect = 9e-23 Identities = 47/68 (69%), Positives = 54/68 (79%) Frame = -3 Query: 410 SEKLAIAFGHAHIPPNMPIRVMKNLRVCGDCHNWTKFFSKMTRREVIVRDGRRFHHFMDG 231 SE+LAIAFG PP PIR+ KNLRVCGDCHN TKF S++T+RE++VRD RFHHF DG Sbjct: 824 SERLAIAFGIISTPPKSPIRIFKNLRVCGDCHNATKFISRITQREIVVRDSNRFHHFKDG 883 Query: 230 FCSCKDYW 207 CSC DYW Sbjct: 884 ICSCGDYW 891 >emb|CBI32403.3| unnamed protein product [Vitis vinifera] Length = 658 Score = 111 bits (278), Expect = 9e-23 Identities = 47/68 (69%), Positives = 54/68 (79%) Frame = -3 Query: 410 SEKLAIAFGHAHIPPNMPIRVMKNLRVCGDCHNWTKFFSKMTRREVIVRDGRRFHHFMDG 231 SE+LAIAFG PP PIR+ KNLRVCGDCHN TKF S++T+RE++VRD RFHHF DG Sbjct: 591 SERLAIAFGIISTPPKSPIRIFKNLRVCGDCHNATKFISRITQREIVVRDSNRFHHFKDG 650 Query: 230 FCSCKDYW 207 CSC DYW Sbjct: 651 ICSCGDYW 658 >emb|CAN64990.1| hypothetical protein VITISV_001772 [Vitis vinifera] Length = 891 Score = 111 bits (278), Expect = 9e-23 Identities = 47/68 (69%), Positives = 54/68 (79%) Frame = -3 Query: 410 SEKLAIAFGHAHIPPNMPIRVMKNLRVCGDCHNWTKFFSKMTRREVIVRDGRRFHHFMDG 231 SE+LAIAFG PP PIR+ KNLRVCGDCHN TKF S++T+RE++VRD RFHHF DG Sbjct: 824 SERLAIAFGIISTPPKSPIRIFKNLRVCGDCHNATKFISRITQREIVVRDSNRFHHFKDG 883 Query: 230 FCSCKDYW 207 CSC DYW Sbjct: 884 ICSCGDYW 891 >ref|XP_007031218.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 1 [Theobroma cacao] gi|590644940|ref|XP_007031219.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 1 [Theobroma cacao] gi|508719823|gb|EOY11720.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 1 [Theobroma cacao] gi|508719824|gb|EOY11721.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 1 [Theobroma cacao] Length = 731 Score = 110 bits (275), Expect = 2e-22 Identities = 46/68 (67%), Positives = 55/68 (80%) Frame = -3 Query: 410 SEKLAIAFGHAHIPPNMPIRVMKNLRVCGDCHNWTKFFSKMTRREVIVRDGRRFHHFMDG 231 SEKLA+A+G +P MPIRVMKNLRVCGDCH K +K+T+RE+I+RD RFHHF DG Sbjct: 664 SEKLAVAYGLLKLPKEMPIRVMKNLRVCGDCHTAIKLIAKVTKREIILRDANRFHHFKDG 723 Query: 230 FCSCKDYW 207 FCSC+DYW Sbjct: 724 FCSCRDYW 731 >ref|XP_006651472.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Oryza brachyantha] Length = 749 Score = 110 bits (274), Expect = 3e-22 Identities = 46/68 (67%), Positives = 54/68 (79%) Frame = -3 Query: 410 SEKLAIAFGHAHIPPNMPIRVMKNLRVCGDCHNWTKFFSKMTRREVIVRDGRRFHHFMDG 231 SE+LAIAFG + PP P+ + KNLRVCGDCHN TKF SK+T RE+IVRD RFHHF DG Sbjct: 682 SERLAIAFGIINTPPGTPLHIYKNLRVCGDCHNATKFISKITEREIIVRDSNRFHHFKDG 741 Query: 230 FCSCKDYW 207 +CSC D+W Sbjct: 742 YCSCGDFW 749 >ref|XP_003553033.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X1 [Glycine max] gi|571544149|ref|XP_006602168.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X2 [Glycine max] gi|571544153|ref|XP_006602169.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X3 [Glycine max] gi|571544157|ref|XP_006602170.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X4 [Glycine max] gi|571544163|ref|XP_006602171.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X5 [Glycine max] Length = 824 Score = 110 bits (274), Expect = 3e-22 Identities = 47/68 (69%), Positives = 52/68 (76%) Frame = -3 Query: 410 SEKLAIAFGHAHIPPNMPIRVMKNLRVCGDCHNWTKFFSKMTRREVIVRDGRRFHHFMDG 231 SE+LAI FG PP PIR+ KNLRVCGDCHN TK+ SK+T RE+IVRD RFHHF DG Sbjct: 757 SERLAIVFGIISTPPKSPIRIFKNLRVCGDCHNATKYISKITEREIIVRDSNRFHHFKDG 816 Query: 230 FCSCKDYW 207 CSC DYW Sbjct: 817 ICSCGDYW 824 >ref|XP_004509764.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g68930-like isoform X1 [Cicer arietinum] gi|502154626|ref|XP_004509765.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g68930-like isoform X2 [Cicer arietinum] Length = 744 Score = 109 bits (273), Expect = 3e-22 Identities = 47/68 (69%), Positives = 56/68 (82%) Frame = -3 Query: 410 SEKLAIAFGHAHIPPNMPIRVMKNLRVCGDCHNWTKFFSKMTRREVIVRDGRRFHHFMDG 231 SEKLAIAFG IPP +PIR++KNLRVCGDCHN TK+ SK+T+RE++VRD RFH F DG Sbjct: 677 SEKLAIAFGLLFIPPGLPIRIVKNLRVCGDCHNATKYISKITQREILVRDAARFHLFKDG 736 Query: 230 FCSCKDYW 207 CSC D+W Sbjct: 737 ICSCGDFW 744 >ref|XP_002277031.2| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Vitis vinifera] Length = 703 Score = 109 bits (273), Expect = 3e-22 Identities = 46/68 (67%), Positives = 55/68 (80%) Frame = -3 Query: 410 SEKLAIAFGHAHIPPNMPIRVMKNLRVCGDCHNWTKFFSKMTRREVIVRDGRRFHHFMDG 231 SE+LA+AFG +P MPIRVMKNLRVCGDCH+ K +K+T RE+I+RD RFHHF DG Sbjct: 636 SERLAVAFGLLKVPEGMPIRVMKNLRVCGDCHSAIKLIAKITGREIILRDANRFHHFKDG 695 Query: 230 FCSCKDYW 207 FCSC+DYW Sbjct: 696 FCSCRDYW 703 >emb|CBI39641.3| unnamed protein product [Vitis vinifera] Length = 251 Score = 109 bits (273), Expect = 3e-22 Identities = 46/68 (67%), Positives = 55/68 (80%) Frame = -3 Query: 410 SEKLAIAFGHAHIPPNMPIRVMKNLRVCGDCHNWTKFFSKMTRREVIVRDGRRFHHFMDG 231 SE+LA+AFG +P MPIRVMKNLRVCGDCH+ K +K+T RE+I+RD RFHHF DG Sbjct: 184 SERLAVAFGLLKVPEGMPIRVMKNLRVCGDCHSAIKLIAKITGREIILRDANRFHHFKDG 243 Query: 230 FCSCKDYW 207 FCSC+DYW Sbjct: 244 FCSCRDYW 251 >ref|XP_007138310.1| hypothetical protein PHAVU_009G197900g [Phaseolus vulgaris] gi|561011397|gb|ESW10304.1| hypothetical protein PHAVU_009G197900g [Phaseolus vulgaris] Length = 747 Score = 109 bits (272), Expect = 5e-22 Identities = 48/68 (70%), Positives = 56/68 (82%) Frame = -3 Query: 410 SEKLAIAFGHAHIPPNMPIRVMKNLRVCGDCHNWTKFFSKMTRREVIVRDGRRFHHFMDG 231 SEKLAIAFG IPP +PIRV+KNLRVCGDCHN TK+ SK+T+RE++VRD RFH F DG Sbjct: 680 SEKLAIAFGLIFIPPGLPIRVVKNLRVCGDCHNATKYISKITQREILVRDAARFHLFKDG 739 Query: 230 FCSCKDYW 207 CSC D+W Sbjct: 740 TCSCGDFW 747 >ref|XP_004493379.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Cicer arietinum] Length = 824 Score = 109 bits (272), Expect = 5e-22 Identities = 45/68 (66%), Positives = 53/68 (77%) Frame = -3 Query: 410 SEKLAIAFGHAHIPPNMPIRVMKNLRVCGDCHNWTKFFSKMTRREVIVRDGRRFHHFMDG 231 SE+LAIAFG PP PIR+ KNLRVCGDCHN TK+ S++T R+++VRD RFHHF DG Sbjct: 757 SERLAIAFGIISTPPRSPIRIFKNLRVCGDCHNATKYISRITERDIVVRDSNRFHHFKDG 816 Query: 230 FCSCKDYW 207 CSC DYW Sbjct: 817 ICSCDDYW 824 >ref|XP_007198996.1| hypothetical protein PRUPE_ppa002176mg [Prunus persica] gi|462394396|gb|EMJ00195.1| hypothetical protein PRUPE_ppa002176mg [Prunus persica] Length = 705 Score = 109 bits (272), Expect = 5e-22 Identities = 48/68 (70%), Positives = 52/68 (76%) Frame = -3 Query: 410 SEKLAIAFGHAHIPPNMPIRVMKNLRVCGDCHNWTKFFSKMTRREVIVRDGRRFHHFMDG 231 SE+LAIAFG PP PIR+ KNLRVCGDCHN TKF S +T RE+IVRD RFHHF DG Sbjct: 638 SERLAIAFGLISTPPKTPIRIFKNLRVCGDCHNATKFISVITEREIIVRDSNRFHHFKDG 697 Query: 230 FCSCKDYW 207 CSC DYW Sbjct: 698 ACSCGDYW 705 >ref|XP_002267613.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g68930 [Vitis vinifera] gi|297738214|emb|CBI27415.3| unnamed protein product [Vitis vinifera] Length = 743 Score = 109 bits (272), Expect = 5e-22 Identities = 48/68 (70%), Positives = 56/68 (82%) Frame = -3 Query: 410 SEKLAIAFGHAHIPPNMPIRVMKNLRVCGDCHNWTKFFSKMTRREVIVRDGRRFHHFMDG 231 SEKLAIAFG +PP +PIRV+KNLRVCGDCHN TKF SK+T+RE++VRD RFH F DG Sbjct: 676 SEKLAIAFGLIFVPPGLPIRVIKNLRVCGDCHNATKFISKITQREILVRDAVRFHLFKDG 735 Query: 230 FCSCKDYW 207 CSC D+W Sbjct: 736 TCSCGDFW 743 >ref|XP_006578628.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like isoform X2 [Glycine max] gi|571451096|ref|XP_003522381.2| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like isoform X1 [Glycine max] gi|571451098|ref|XP_006578629.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like isoform X3 [Glycine max] gi|571451100|ref|XP_006578630.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like isoform X4 [Glycine max] Length = 640 Score = 108 bits (271), Expect = 6e-22 Identities = 48/71 (67%), Positives = 56/71 (78%) Frame = -3 Query: 410 SEKLAIAFGHAHIPPNMPIRVMKNLRVCGDCHNWTKFFSKMTRREVIVRDGRRFHHFMDG 231 SEKLAIAFG +P +PIRV KNLRVCGDCH+ TK+ S + RE+IVRD RFHHF DG Sbjct: 568 SEKLAIAFGLLKVPLGVPIRVFKNLRVCGDCHSATKYISTIEGREIIVRDTTRFHHFKDG 627 Query: 230 FCSCKDYW*FF 198 FCSC+DYW F+ Sbjct: 628 FCSCRDYWTFY 638 >ref|XP_007042438.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508706373|gb|EOX98269.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 820 Score = 108 bits (271), Expect = 6e-22 Identities = 47/68 (69%), Positives = 53/68 (77%) Frame = -3 Query: 410 SEKLAIAFGHAHIPPNMPIRVMKNLRVCGDCHNWTKFFSKMTRREVIVRDGRRFHHFMDG 231 SE+LAIA+G PP PIR+ KNLRVCGDCHN TKF S++T RE+IVRD RFHHF DG Sbjct: 753 SERLAIAYGIISSPPKSPIRIFKNLRVCGDCHNATKFISQITDREIIVRDSNRFHHFKDG 812 Query: 230 FCSCKDYW 207 CSC DYW Sbjct: 813 ICSCGDYW 820 >ref|XP_004304914.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 703 Score = 108 bits (271), Expect = 6e-22 Identities = 47/68 (69%), Positives = 54/68 (79%) Frame = -3 Query: 410 SEKLAIAFGHAHIPPNMPIRVMKNLRVCGDCHNWTKFFSKMTRREVIVRDGRRFHHFMDG 231 SEKLAIA+G +P MPIRVMKNLRVCGDCH+ K +K+T RE+IVRD RFHHF DG Sbjct: 636 SEKLAIAYGLLKVPQGMPIRVMKNLRVCGDCHSAIKLIAKVTGREIIVRDANRFHHFKDG 695 Query: 230 FCSCKDYW 207 CSC+DYW Sbjct: 696 LCSCRDYW 703 >ref|XP_003541343.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g68930-like isoform X1 [Glycine max] gi|571497773|ref|XP_006594017.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g68930-like isoform X2 [Glycine max] Length = 747 Score = 108 bits (271), Expect = 6e-22 Identities = 48/68 (70%), Positives = 56/68 (82%) Frame = -3 Query: 410 SEKLAIAFGHAHIPPNMPIRVMKNLRVCGDCHNWTKFFSKMTRREVIVRDGRRFHHFMDG 231 SEKLAIAFG IPP +PIRV+KNLRVCGDCHN TK+ SK+T+RE++VRD RFH F DG Sbjct: 680 SEKLAIAFGLIFIPPGLPIRVVKNLRVCGDCHNATKYISKITQREILVRDAARFHLFKDG 739 Query: 230 FCSCKDYW 207 CSC D+W Sbjct: 740 RCSCGDFW 747 >gb|ABF96424.1| pentatricopeptide, putative [Oryza sativa Japonica Group] gi|125586550|gb|EAZ27214.1| hypothetical protein OsJ_11153 [Oryza sativa Japonica Group] Length = 748 Score = 108 bits (271), Expect = 6e-22 Identities = 45/68 (66%), Positives = 54/68 (79%) Frame = -3 Query: 410 SEKLAIAFGHAHIPPNMPIRVMKNLRVCGDCHNWTKFFSKMTRREVIVRDGRRFHHFMDG 231 SE+LAIAFG + PP P+ + KNLRVCGDCHN TK+ SK+T RE+IVRD RFHHF DG Sbjct: 681 SERLAIAFGIINTPPRTPLHIYKNLRVCGDCHNATKYISKITEREIIVRDSNRFHHFKDG 740 Query: 230 FCSCKDYW 207 +CSC D+W Sbjct: 741 YCSCGDFW 748