BLASTX nr result
ID: Akebia23_contig00040375
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00040375 (254 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EQL00817.1| hypothetical protein OCS_03471 [Ophiocordyceps si... 57 3e-06 >gb|EQL00817.1| hypothetical protein OCS_03471 [Ophiocordyceps sinensis CO18] Length = 458 Score = 56.6 bits (135), Expect = 3e-06 Identities = 36/83 (43%), Positives = 44/83 (53%), Gaps = 1/83 (1%) Frame = +3 Query: 6 IHKLESLTIRTDSQSGSLVGPWLPY-FSEADFHELVCKLSNLRHLYFKVQCDMSPTAFRS 182 + LE LTI D + V L FS+ F +LV L LR F VQC +S A S Sbjct: 299 LSNLEELTIVADERYDEAVVTALEAGFSDQHFDDLVSHLPRLRCFNFLVQCTLSGAALLS 358 Query: 183 LSTSCPQLRCCSLSQVFDMQALE 251 LS CP L C++ QVFD+Q LE Sbjct: 359 LSKHCPLLEECNMLQVFDIQELE 381