BLASTX nr result
ID: Akebia23_contig00038678
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00038678 (310 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003855507.1| cutinase [Zymoseptoria tritici IPO323] gi|33... 66 4e-09 ref|XP_007592702.1| cutinase [Colletotrichum fioriniae PJ7] gi|5... 60 3e-07 ref|XP_751420.1| cutinase [Aspergillus fumigatus Af293] gi|74671... 60 3e-07 ref|XP_746507.1| cutinase [Aspergillus fumigatus Af293] gi|74666... 60 3e-07 ref|XP_003847891.1| cutinase [Zymoseptoria tritici IPO323] gi|33... 60 4e-07 ref|XP_001267857.1| cutinase, putative [Aspergillus clavatus NRR... 60 4e-07 ref|XP_001262489.1| cutinase, putative [Neosartorya fischeri NRR... 59 5e-07 ref|XP_001266632.1| cutinase family protein [Neosartorya fischer... 59 5e-07 ref|XP_755273.1| cutinase [Aspergillus fumigatus Af293] gi|74675... 59 7e-07 ref|XP_001260434.1| cutinase, putative [Neosartorya fischeri NRR... 59 7e-07 ref|XP_001217054.1| cutinase precursor [Aspergillus terreus NIH2... 59 9e-07 ref|XP_662913.1| hypothetical protein AN5309.2 [Aspergillus nidu... 59 9e-07 ref|XP_001825799.1| cutinase 1 [Aspergillus oryzae RIB40] gi|121... 58 1e-06 ref|XP_002558946.1| Pc13g05110 [Penicillium chrysogenum Wisconsi... 58 1e-06 ref|XP_002377397.1| cutinase, putative [Aspergillus flavus NRRL3... 58 2e-06 gb|EQB59021.1| cutinase [Colletotrichum gloeosporioides Cg-14] 57 3e-06 sp|Q2TZY7.1|CUTI2_ASPOR RecName: Full=Probable cutinase 2; AltNa... 57 3e-06 ref|XP_001826261.2| cutinase 2 [Aspergillus oryzae RIB40] gi|300... 57 3e-06 ref|XP_002377949.1| cutinase, putative [Aspergillus flavus NRRL3... 57 3e-06 ref|XP_001274910.1| cutinase, putative [Aspergillus clavatus NRR... 57 3e-06 >ref|XP_003855507.1| cutinase [Zymoseptoria tritici IPO323] gi|339475391|gb|EGP90483.1| cutinase [Zymoseptoria tritici IPO323] Length = 216 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +1 Query: 175 SSVSNELTIGACRRITFIFARGSTEPGNIGSSVGPGTCNELKRR 306 SS SNELT GACR + FIFARG+TE GN+GS+VGP TC+ LK R Sbjct: 28 SSTSNELTSGACRDVIFIFARGTTERGNMGSTVGPQTCSALKSR 71 >ref|XP_007592702.1| cutinase [Colletotrichum fioriniae PJ7] gi|588903483|gb|EXF83572.1| cutinase [Colletotrichum fioriniae PJ7] Length = 227 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/48 (56%), Positives = 35/48 (72%) Frame = +1 Query: 166 RQLSSVSNELTIGACRRITFIFARGSTEPGNIGSSVGPGTCNELKRRY 309 RQ ++ E T G CR + FIFARGSTE GN+GS+VGP T + LK++Y Sbjct: 36 RQTGIIAKEYTQGGCRDVIFIFARGSTEVGNMGSTVGPSTSDGLKKKY 83 >ref|XP_751420.1| cutinase [Aspergillus fumigatus Af293] gi|74671897|sp|Q4WQV2.1|CUTI2_ASPFU RecName: Full=Probable cutinase 2; AltName: Full=Cutin hydrolase 2; Flags: Precursor gi|300680913|sp|B0Y537.1|CUTI2_ASPFC RecName: Full=Probable cutinase 2; AltName: Full=Cutin hydrolase 2; Flags: Precursor gi|66849054|gb|EAL89382.1| cutinase, putative [Aspergillus fumigatus Af293] gi|159125669|gb|EDP50786.1| cutinase, putative [Aspergillus fumigatus A1163] Length = 214 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/45 (68%), Positives = 33/45 (73%) Frame = +1 Query: 166 RQLSSVSNELTIGACRRITFIFARGSTEPGNIGSSVGPGTCNELK 300 RQLSS NEL GAC+ ITFIFAR STEPG +G S GP CN LK Sbjct: 24 RQLSS-GNELRNGACKPITFIFARASTEPGLMGLSTGPAVCNSLK 67 >ref|XP_746507.1| cutinase [Aspergillus fumigatus Af293] gi|74666356|sp|Q4W9Z4.1|CUTI3_ASPFU RecName: Full=Probable cutinase 3; AltName: Full=Cutin hydrolase 3; Flags: Precursor gi|300680917|sp|B0YEP5.1|CUTI3_ASPFC RecName: Full=Probable cutinase 3; AltName: Full=Cutin hydrolase 3; Flags: Precursor gi|66844130|gb|EAL84469.1| cutinase, putative [Aspergillus fumigatus Af293] gi|159122267|gb|EDP47389.1| cutinase, putative [Aspergillus fumigatus A1163] Length = 217 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = +1 Query: 184 SNELTIGACRRITFIFARGSTEPGNIGSSVGPGTCNELKR 303 SNEL G CR +TFIFARGSTE GN+G VGPG C+ LK+ Sbjct: 31 SNELESGPCRDVTFIFARGSTEQGNMGLIVGPGVCSSLKK 70 >ref|XP_003847891.1| cutinase [Zymoseptoria tritici IPO323] gi|339467765|gb|EGP82867.1| cutinase [Zymoseptoria tritici IPO323] Length = 231 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = +1 Query: 184 SNELTIGACRRITFIFARGSTEPGNIGSSVGPGTCNELKRRY 309 S EL GAC++ITFI+ARGSTEPGN+G GP TC+ LK +Y Sbjct: 43 STELENGACKQITFIYARGSTEPGNMGIVPGPQTCDALKSQY 84 >ref|XP_001267857.1| cutinase, putative [Aspergillus clavatus NRRL 1] gi|300680907|sp|A1CSZ4.1|CUTI1_ASPCL RecName: Full=Probable cutinase 1; AltName: Full=Cutin hydrolase 1; Flags: Precursor gi|119395999|gb|EAW06431.1| cutinase, putative [Aspergillus clavatus NRRL 1] Length = 211 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 166 RQLSSVSNELTIGACRRITFIFARGSTEPGNIGSSVGPGTCNELK 300 RQ++ NEL G C ITFIFAR STEPG +G S GPG CN LK Sbjct: 22 RQIAIPENELRTGPCEPITFIFARASTEPGLLGISTGPGVCNGLK 66 >ref|XP_001262489.1| cutinase, putative [Neosartorya fischeri NRRL 181] gi|300680929|sp|A1D9W1.1|CUTI3_NEOFI RecName: Full=Probable cutinase 3; AltName: Full=Cutin hydrolase 3; Flags: Precursor gi|119410646|gb|EAW20592.1| cutinase, putative [Neosartorya fischeri NRRL 181] Length = 217 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = +1 Query: 184 SNELTIGACRRITFIFARGSTEPGNIGSSVGPGTCNELK 300 SNEL G CR +TFIFARGSTE GN+G VGPG C+ LK Sbjct: 31 SNELESGPCRDVTFIFARGSTEQGNMGFIVGPGVCSSLK 69 >ref|XP_001266632.1| cutinase family protein [Neosartorya fischeri NRRL 181] gi|300680914|sp|A1CVT3.1|CUTI2_NEOFI RecName: Full=Probable cutinase 2; AltName: Full=Cutin hydrolase 2; Flags: Precursor gi|119414797|gb|EAW24735.1| cutinase family protein [Neosartorya fischeri NRRL 181] Length = 215 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/45 (66%), Positives = 32/45 (71%) Frame = +1 Query: 166 RQLSSVSNELTIGACRRITFIFARGSTEPGNIGSSVGPGTCNELK 300 RQ SS NEL GAC+ ITFIFAR STEPG +G S GP CN LK Sbjct: 24 RQFSS-GNELRDGACKPITFIFARASTEPGLLGMSTGPAVCNNLK 67 >ref|XP_755273.1| cutinase [Aspergillus fumigatus Af293] gi|74675656|sp|Q4X1N0.1|CUTI1_ASPFU RecName: Full=Probable cutinase 1; AltName: Full=Cutin hydrolase 1; Flags: Precursor gi|300680908|sp|B0XRY3.1|CUTI1_ASPFC RecName: Full=Probable cutinase 1; AltName: Full=Cutin hydrolase 1; Flags: Precursor gi|66852911|gb|EAL93235.1| cutinase, putative [Aspergillus fumigatus Af293] gi|159129355|gb|EDP54469.1| cutinase, putative [Aspergillus fumigatus A1163] Length = 211 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/45 (60%), Positives = 31/45 (68%) Frame = +1 Query: 166 RQLSSVSNELTIGACRRITFIFARGSTEPGNIGSSVGPGTCNELK 300 RQ + +EL G C ITFIFARGSTEPG +G + GPG CN LK Sbjct: 22 RQTAITGDELRTGPCEPITFIFARGSTEPGLLGITTGPGVCNALK 66 >ref|XP_001260434.1| cutinase, putative [Neosartorya fischeri NRRL 181] gi|300680911|sp|A1DGN0.1|CUTI1_NEOFI RecName: Full=Probable cutinase 1; AltName: Full=Cutin hydrolase 1; Flags: Precursor gi|119408588|gb|EAW18537.1| cutinase, putative [Neosartorya fischeri NRRL 181] Length = 211 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/45 (60%), Positives = 31/45 (68%) Frame = +1 Query: 166 RQLSSVSNELTIGACRRITFIFARGSTEPGNIGSSVGPGTCNELK 300 RQ + +EL G C ITFIFARGSTEPG +G + GPG CN LK Sbjct: 22 RQTAIAGDELRTGPCEPITFIFARGSTEPGLLGITTGPGVCNALK 66 >ref|XP_001217054.1| cutinase precursor [Aspergillus terreus NIH2624] gi|121734961|sp|Q0CD01.1|CUTI1_ASPTN RecName: Full=Probable cutinase 1; AltName: Full=Cutin hydrolase 1; Flags: Precursor gi|114189906|gb|EAU31606.1| cutinase precursor [Aspergillus terreus NIH2624] Length = 209 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = +1 Query: 187 NELTIGACRRITFIFARGSTEPGNIGSSVGPGTCNELK 300 NEL +GAC ITFIFAR STE G +G S GPG CN LK Sbjct: 27 NELRVGACEEITFIFARASTETGYLGGSTGPGVCNGLK 64 >ref|XP_662913.1| hypothetical protein AN5309.2 [Aspergillus nidulans FGSC A4] gi|74595242|sp|Q5B2C1.1|CUTI1_EMENI RecName: Full=Probable cutinase 1; AltName: Full=Cutin hydrolase 1; Flags: Precursor gi|40743279|gb|EAA62469.1| hypothetical protein AN5309.2 [Aspergillus nidulans FGSC A4] gi|259485251|tpe|CBF82125.1| TPA: cutinase, putative (AFU_orthologue; AFUA_2G09380) [Aspergillus nidulans FGSC A4] Length = 213 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/46 (60%), Positives = 32/46 (69%) Frame = +1 Query: 169 QLSSVSNELTIGACRRITFIFARGSTEPGNIGSSVGPGTCNELKRR 306 Q NEL G+C +TFIFARGSTE G +GS+VGP TCN LK R Sbjct: 25 QRQITGNELRDGSCHDVTFIFARGSTELGYLGSTVGPATCNVLKLR 70 >ref|XP_001825799.1| cutinase 1 [Aspergillus oryzae RIB40] gi|121798359|sp|Q2U199.1|CUTI3_ASPOR RecName: Full=Probable cutinase 3; AltName: Full=Cutin hydrolase 3; Flags: Precursor gi|83774543|dbj|BAE64666.1| unnamed protein product [Aspergillus oryzae RIB40] gi|393659846|dbj|BAM28634.1| cutinase C [Aspergillus oryzae] Length = 224 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = +1 Query: 166 RQLSSVSNELTIGACRRITFIFARGSTEPGNIGSSVGPGTCNELKRR 306 RQL S SN+LT GAC+ +T IFARGSTE GN+G+ +GP C+ LK + Sbjct: 32 RQLGS-SNDLTNGACKDVTLIFARGSTEMGNMGTVIGPPLCSSLKSK 77 >ref|XP_002558946.1| Pc13g05110 [Penicillium chrysogenum Wisconsin 54-1255] gi|300680915|sp|B6H2E9.1|CUTI2_PENCW RecName: Full=Probable cutinase 2; AltName: Full=Cutin hydrolase 2; Flags: Precursor gi|211583566|emb|CAP91580.1| Pc13g05110 [Penicillium chrysogenum Wisconsin 54-1255] Length = 212 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/45 (60%), Positives = 31/45 (68%) Frame = +1 Query: 166 RQLSSVSNELTIGACRRITFIFARGSTEPGNIGSSVGPGTCNELK 300 RQ SS NEL G C+ +TFIFAR STE G +G S GP CN+LK Sbjct: 22 RQTSSSGNELRDGPCQPVTFIFARASTEQGLLGGSTGPAVCNDLK 66 >ref|XP_002377397.1| cutinase, putative [Aspergillus flavus NRRL3357] gi|300680918|sp|B8NCM8.1|CUTI3_ASPFN RecName: Full=Probable cutinase 1; AltName: Full=Cutin hydrolase 1; Flags: Precursor gi|220695891|gb|EED52233.1| cutinase, putative [Aspergillus flavus NRRL3357] Length = 224 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = +1 Query: 166 RQLSSVSNELTIGACRRITFIFARGSTEPGNIGSSVGPGTCNELKRR 306 RQL S SN+LT GAC+ +T IFARGSTE GN+G+ +GP C+ LK + Sbjct: 32 RQLGS-SNDLTNGACKDVTLIFARGSTEMGNMGTVIGPPLCSALKSK 77 >gb|EQB59021.1| cutinase [Colletotrichum gloeosporioides Cg-14] Length = 226 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/48 (52%), Positives = 34/48 (70%) Frame = +1 Query: 166 RQLSSVSNELTIGACRRITFIFARGSTEPGNIGSSVGPGTCNELKRRY 309 R+ + + E T G CR + FIFARGS E GN+GS+VGP T + LK++Y Sbjct: 35 RETGTTAKEFTKGGCRDVIFIFARGSVETGNMGSTVGPPTSDGLKKKY 82 >sp|Q2TZY7.1|CUTI2_ASPOR RecName: Full=Probable cutinase 2; AltName: Full=Cutin hydrolase 2; Flags: Precursor gi|83775005|dbj|BAE65128.1| unnamed protein product [Aspergillus oryzae RIB40] gi|391868986|gb|EIT78193.1| Cutin hydrolase 2 [Aspergillus oryzae 3.042] Length = 221 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/45 (64%), Positives = 32/45 (71%) Frame = +1 Query: 166 RQLSSVSNELTIGACRRITFIFARGSTEPGNIGSSVGPGTCNELK 300 RQLS NEL G+C+ ITFIFAR STEPG +G S GP CN LK Sbjct: 24 RQLSG-GNELRDGSCKPITFIFARASTEPGLLGISTGPAVCNGLK 67 >ref|XP_001826261.2| cutinase 2 [Aspergillus oryzae RIB40] gi|300680994|sp|B8NBB2.2|CUTI2_ASPFN RecName: Full=Probable cutinase 2; AltName: Full=Cutin hydrolase 2; Flags: Precursor Length = 259 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/45 (64%), Positives = 32/45 (71%) Frame = +1 Query: 166 RQLSSVSNELTIGACRRITFIFARGSTEPGNIGSSVGPGTCNELK 300 RQLS NEL G+C+ ITFIFAR STEPG +G S GP CN LK Sbjct: 24 RQLSG-GNELRDGSCKPITFIFARASTEPGLLGISTGPAVCNGLK 67 >ref|XP_002377949.1| cutinase, putative [Aspergillus flavus NRRL3357] gi|220696443|gb|EED52785.1| cutinase, putative [Aspergillus flavus NRRL3357] Length = 304 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/45 (64%), Positives = 32/45 (71%) Frame = +1 Query: 166 RQLSSVSNELTIGACRRITFIFARGSTEPGNIGSSVGPGTCNELK 300 RQLS NEL G+C+ ITFIFAR STEPG +G S GP CN LK Sbjct: 69 RQLSG-GNELRDGSCKPITFIFARASTEPGLLGISTGPAVCNGLK 112 >ref|XP_001274910.1| cutinase, putative [Aspergillus clavatus NRRL 1] gi|300680916|sp|A1C9G0.1|CUTI3_ASPCL RecName: Full=Probable cutinase 3; AltName: Full=Cutin hydrolase 3; Flags: Precursor gi|119403064|gb|EAW13484.1| cutinase, putative [Aspergillus clavatus NRRL 1] Length = 215 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/39 (69%), Positives = 29/39 (74%) Frame = +1 Query: 184 SNELTIGACRRITFIFARGSTEPGNIGSSVGPGTCNELK 300 SNEL G CR +TFIFARGSTE GN+G VGP TC LK Sbjct: 31 SNELENGPCRDVTFIFARGSTEQGNMGFIVGPPTCTALK 69