BLASTX nr result
ID: Akebia23_contig00038576
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00038576 (515 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q945U1.1|RS15_ELAOL RecName: Full=40S ribosomal protein S15 g... 75 1e-11 gb|ADR71252.1| 40S ribosomal protein S15E [Hevea brasiliensis] 72 6e-11 gb|ADR71251.1| 40S ribosomal protein S15D [Hevea brasiliensis] 72 6e-11 emb|CBI26366.3| unnamed protein product [Vitis vinifera] 72 6e-11 ref|XP_002284241.1| PREDICTED: 40S ribosomal protein S15-like is... 72 6e-11 gb|ACI14379.1| 40S ribosomal protein S15-like protein [Forsythia... 72 6e-11 gb|EXB93222.1| 40S ribosomal protein S15 [Morus notabilis] 69 9e-10 gb|EXB29864.1| 40S ribosomal protein S15 [Morus notabilis] 69 9e-10 ref|XP_007034979.1| 40S ribosomal protein S15-like isoform 1 [Th... 69 9e-10 ref|XP_007050396.1| 40S ribosomal protein S15-like [Theobroma ca... 69 9e-10 ref|XP_004302063.1| PREDICTED: 40S ribosomal protein S15-like [F... 69 9e-10 ref|XP_004288443.1| PREDICTED: 40S ribosomal protein S15-like is... 69 9e-10 ref|XP_004288442.1| PREDICTED: 40S ribosomal protein S15-like is... 69 9e-10 ref|XP_007206076.1| hypothetical protein PRUPE_ppa012840mg [Prun... 69 9e-10 ref|XP_002517015.1| 40S ribosomal protein S15, putative [Ricinus... 69 9e-10 ref|XP_002520996.1| 40S ribosomal protein S15, putative [Ricinus... 69 9e-10 ref|XP_001761245.1| predicted protein [Physcomitrella patens] gi... 69 9e-10 ref|XP_001767284.1| predicted protein [Physcomitrella patens] gi... 69 9e-10 ref|XP_001773593.1| predicted protein [Physcomitrella patens] gi... 69 9e-10 ref|XP_002307632.1| hypothetical protein POPTR_0005s24120g [Popu... 69 9e-10 >sp|Q945U1.1|RS15_ELAOL RecName: Full=40S ribosomal protein S15 gi|15425963|gb|AAK97632.1| 40S ribosomal protein S15 [Elaeis oleifera] Length = 153 Score = 74.7 bits (182), Expect = 1e-11 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -1 Query: 332 MGTDELVKLFHARARRRFQRGLKRKPMALIKKLRKAVR 219 MGTDELVKLFHARARRRFQRGLKRKPMALIKKLRKA R Sbjct: 36 MGTDELVKLFHARARRRFQRGLKRKPMALIKKLRKAKR 73 >gb|ADR71252.1| 40S ribosomal protein S15E [Hevea brasiliensis] Length = 151 Score = 72.4 bits (176), Expect = 6e-11 Identities = 36/38 (94%), Positives = 36/38 (94%) Frame = -1 Query: 332 MGTDELVKLFHARARRRFQRGLKRKPMALIKKLRKAVR 219 M TDELVKLFHARARRRFQRGLKRKPMALIKKLRKA R Sbjct: 34 MSTDELVKLFHARARRRFQRGLKRKPMALIKKLRKAKR 71 >gb|ADR71251.1| 40S ribosomal protein S15D [Hevea brasiliensis] Length = 151 Score = 72.4 bits (176), Expect = 6e-11 Identities = 36/38 (94%), Positives = 36/38 (94%) Frame = -1 Query: 332 MGTDELVKLFHARARRRFQRGLKRKPMALIKKLRKAVR 219 M TDELVKLFHARARRRFQRGLKRKPMALIKKLRKA R Sbjct: 34 MSTDELVKLFHARARRRFQRGLKRKPMALIKKLRKAKR 71 >emb|CBI26366.3| unnamed protein product [Vitis vinifera] Length = 118 Score = 72.4 bits (176), Expect = 6e-11 Identities = 36/38 (94%), Positives = 36/38 (94%) Frame = -1 Query: 332 MGTDELVKLFHARARRRFQRGLKRKPMALIKKLRKAVR 219 M TDELVKLFHARARRRFQRGLKRKPMALIKKLRKA R Sbjct: 1 MSTDELVKLFHARARRRFQRGLKRKPMALIKKLRKAKR 38 >ref|XP_002284241.1| PREDICTED: 40S ribosomal protein S15-like isoform 1 [Vitis vinifera] gi|359477606|ref|XP_003632002.1| PREDICTED: 40S ribosomal protein S15-like isoform 2 [Vitis vinifera] Length = 151 Score = 72.4 bits (176), Expect = 6e-11 Identities = 36/38 (94%), Positives = 36/38 (94%) Frame = -1 Query: 332 MGTDELVKLFHARARRRFQRGLKRKPMALIKKLRKAVR 219 M TDELVKLFHARARRRFQRGLKRKPMALIKKLRKA R Sbjct: 34 MSTDELVKLFHARARRRFQRGLKRKPMALIKKLRKAKR 71 >gb|ACI14379.1| 40S ribosomal protein S15-like protein [Forsythia suspensa] Length = 151 Score = 72.4 bits (176), Expect = 6e-11 Identities = 36/38 (94%), Positives = 36/38 (94%) Frame = -1 Query: 332 MGTDELVKLFHARARRRFQRGLKRKPMALIKKLRKAVR 219 M TDELVKLFHARARRRFQRGLKRKPMALIKKLRKA R Sbjct: 34 MSTDELVKLFHARARRRFQRGLKRKPMALIKKLRKAKR 71 >gb|EXB93222.1| 40S ribosomal protein S15 [Morus notabilis] Length = 152 Score = 68.6 bits (166), Expect = 9e-10 Identities = 35/38 (92%), Positives = 35/38 (92%) Frame = -1 Query: 332 MGTDELVKLFHARARRRFQRGLKRKPMALIKKLRKAVR 219 M TDELVKLF ARARRRFQRGLKRKPMALIKKLRKA R Sbjct: 35 MSTDELVKLFTARARRRFQRGLKRKPMALIKKLRKAKR 72 >gb|EXB29864.1| 40S ribosomal protein S15 [Morus notabilis] Length = 152 Score = 68.6 bits (166), Expect = 9e-10 Identities = 35/38 (92%), Positives = 35/38 (92%) Frame = -1 Query: 332 MGTDELVKLFHARARRRFQRGLKRKPMALIKKLRKAVR 219 M TDELVKLF ARARRRFQRGLKRKPMALIKKLRKA R Sbjct: 35 MSTDELVKLFTARARRRFQRGLKRKPMALIKKLRKAKR 72 >ref|XP_007034979.1| 40S ribosomal protein S15-like isoform 1 [Theobroma cacao] gi|590658896|ref|XP_007034980.1| 40S ribosomal protein S15-like isoform 1 [Theobroma cacao] gi|508714008|gb|EOY05905.1| 40S ribosomal protein S15-like isoform 1 [Theobroma cacao] gi|508714009|gb|EOY05906.1| 40S ribosomal protein S15-like isoform 1 [Theobroma cacao] Length = 152 Score = 68.6 bits (166), Expect = 9e-10 Identities = 35/38 (92%), Positives = 35/38 (92%) Frame = -1 Query: 332 MGTDELVKLFHARARRRFQRGLKRKPMALIKKLRKAVR 219 M TDELVKLF ARARRRFQRGLKRKPMALIKKLRKA R Sbjct: 35 MSTDELVKLFPARARRRFQRGLKRKPMALIKKLRKAKR 72 >ref|XP_007050396.1| 40S ribosomal protein S15-like [Theobroma cacao] gi|508702657|gb|EOX94553.1| 40S ribosomal protein S15-like [Theobroma cacao] Length = 152 Score = 68.6 bits (166), Expect = 9e-10 Identities = 35/38 (92%), Positives = 35/38 (92%) Frame = -1 Query: 332 MGTDELVKLFHARARRRFQRGLKRKPMALIKKLRKAVR 219 M TDELVKLF ARARRRFQRGLKRKPMALIKKLRKA R Sbjct: 35 MSTDELVKLFPARARRRFQRGLKRKPMALIKKLRKAKR 72 >ref|XP_004302063.1| PREDICTED: 40S ribosomal protein S15-like [Fragaria vesca subsp. vesca] Length = 152 Score = 68.6 bits (166), Expect = 9e-10 Identities = 35/38 (92%), Positives = 35/38 (92%) Frame = -1 Query: 332 MGTDELVKLFHARARRRFQRGLKRKPMALIKKLRKAVR 219 M TDELVKLF ARARRRFQRGLKRKPMALIKKLRKA R Sbjct: 35 MSTDELVKLFPARARRRFQRGLKRKPMALIKKLRKAKR 72 >ref|XP_004288443.1| PREDICTED: 40S ribosomal protein S15-like isoform 2 [Fragaria vesca subsp. vesca] Length = 118 Score = 68.6 bits (166), Expect = 9e-10 Identities = 35/38 (92%), Positives = 35/38 (92%) Frame = -1 Query: 332 MGTDELVKLFHARARRRFQRGLKRKPMALIKKLRKAVR 219 M TDELVKLF ARARRRFQRGLKRKPMALIKKLRKA R Sbjct: 1 MSTDELVKLFPARARRRFQRGLKRKPMALIKKLRKAKR 38 >ref|XP_004288442.1| PREDICTED: 40S ribosomal protein S15-like isoform 1 [Fragaria vesca subsp. vesca] Length = 152 Score = 68.6 bits (166), Expect = 9e-10 Identities = 35/38 (92%), Positives = 35/38 (92%) Frame = -1 Query: 332 MGTDELVKLFHARARRRFQRGLKRKPMALIKKLRKAVR 219 M TDELVKLF ARARRRFQRGLKRKPMALIKKLRKA R Sbjct: 35 MSTDELVKLFPARARRRFQRGLKRKPMALIKKLRKAKR 72 >ref|XP_007206076.1| hypothetical protein PRUPE_ppa012840mg [Prunus persica] gi|462401718|gb|EMJ07275.1| hypothetical protein PRUPE_ppa012840mg [Prunus persica] Length = 152 Score = 68.6 bits (166), Expect = 9e-10 Identities = 35/38 (92%), Positives = 35/38 (92%) Frame = -1 Query: 332 MGTDELVKLFHARARRRFQRGLKRKPMALIKKLRKAVR 219 M TDELVKLF ARARRRFQRGLKRKPMALIKKLRKA R Sbjct: 35 MSTDELVKLFPARARRRFQRGLKRKPMALIKKLRKAKR 72 >ref|XP_002517015.1| 40S ribosomal protein S15, putative [Ricinus communis] gi|223543650|gb|EEF45178.1| 40S ribosomal protein S15, putative [Ricinus communis] Length = 151 Score = 68.6 bits (166), Expect = 9e-10 Identities = 35/38 (92%), Positives = 35/38 (92%) Frame = -1 Query: 332 MGTDELVKLFHARARRRFQRGLKRKPMALIKKLRKAVR 219 M TDELVKLF ARARRRFQRGLKRKPMALIKKLRKA R Sbjct: 34 MSTDELVKLFTARARRRFQRGLKRKPMALIKKLRKAKR 71 >ref|XP_002520996.1| 40S ribosomal protein S15, putative [Ricinus communis] gi|223539833|gb|EEF41413.1| 40S ribosomal protein S15, putative [Ricinus communis] Length = 152 Score = 68.6 bits (166), Expect = 9e-10 Identities = 35/38 (92%), Positives = 35/38 (92%) Frame = -1 Query: 332 MGTDELVKLFHARARRRFQRGLKRKPMALIKKLRKAVR 219 M TDELVKLF ARARRRFQRGLKRKPMALIKKLRKA R Sbjct: 35 MSTDELVKLFTARARRRFQRGLKRKPMALIKKLRKAKR 72 >ref|XP_001761245.1| predicted protein [Physcomitrella patens] gi|162687585|gb|EDQ73967.1| predicted protein [Physcomitrella patens] Length = 150 Score = 68.6 bits (166), Expect = 9e-10 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -1 Query: 332 MGTDELVKLFHARARRRFQRGLKRKPMALIKKLRKAVR 219 M DELV+LFHARARRRFQRGLKRKPMALIKKLRKA R Sbjct: 33 MSMDELVELFHARARRRFQRGLKRKPMALIKKLRKAKR 70 >ref|XP_001767284.1| predicted protein [Physcomitrella patens] gi|162681539|gb|EDQ67965.1| predicted protein [Physcomitrella patens] Length = 146 Score = 68.6 bits (166), Expect = 9e-10 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -1 Query: 332 MGTDELVKLFHARARRRFQRGLKRKPMALIKKLRKAVR 219 M DELV+LFHARARRRFQRGLKRKPMALIKKLRKA R Sbjct: 29 MSMDELVELFHARARRRFQRGLKRKPMALIKKLRKAKR 66 >ref|XP_001773593.1| predicted protein [Physcomitrella patens] gi|162675132|gb|EDQ61631.1| predicted protein [Physcomitrella patens] Length = 155 Score = 68.6 bits (166), Expect = 9e-10 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -1 Query: 332 MGTDELVKLFHARARRRFQRGLKRKPMALIKKLRKAVR 219 MG DELV+LF+ARARRRFQRGLKRKPMALIKKLRKA R Sbjct: 38 MGNDELVELFNARARRRFQRGLKRKPMALIKKLRKAKR 75 >ref|XP_002307632.1| hypothetical protein POPTR_0005s24120g [Populus trichocarpa] gi|118481495|gb|ABK92690.1| unknown [Populus trichocarpa] gi|118482312|gb|ABK93082.1| unknown [Populus trichocarpa] gi|222857081|gb|EEE94628.1| hypothetical protein POPTR_0005s24120g [Populus trichocarpa] Length = 152 Score = 68.6 bits (166), Expect = 9e-10 Identities = 35/38 (92%), Positives = 35/38 (92%) Frame = -1 Query: 332 MGTDELVKLFHARARRRFQRGLKRKPMALIKKLRKAVR 219 M TDELVKLF ARARRRFQRGLKRKPMALIKKLRKA R Sbjct: 35 MSTDELVKLFPARARRRFQRGLKRKPMALIKKLRKAKR 72