BLASTX nr result
ID: Akebia23_contig00038316
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00038316 (240 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN62734.1| hypothetical protein VITISV_015319 [Vitis vinifera] 57 3e-06 emb|CAN81329.1| hypothetical protein VITISV_039333 [Vitis vinifera] 55 8e-06 emb|CAN78003.1| hypothetical protein VITISV_008442 [Vitis vinifera] 55 8e-06 >emb|CAN62734.1| hypothetical protein VITISV_015319 [Vitis vinifera] Length = 478 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/45 (53%), Positives = 30/45 (66%) Frame = +2 Query: 104 FFVWLASSGRIFALDCLISHGWITPNFCSLCLRNGESVYHILIHC 238 FFVW AS GR+ LD L GW+ N C LC + GES+ H+L+HC Sbjct: 384 FFVWEASWGRVLTLDRLQKKGWVLANRCFLCQKCGESIDHLLLHC 428 >emb|CAN81329.1| hypothetical protein VITISV_039333 [Vitis vinifera] Length = 174 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/45 (55%), Positives = 28/45 (62%) Frame = +2 Query: 104 FFVWLASSGRIFALDCLISHGWITPNFCSLCLRNGESVYHILIHC 238 FF W A+ G++F LD L GW PN C LC ESV HILIHC Sbjct: 100 FFAWEATWGKVFTLDRLQKRGWQLPNLCFLCGCEEESVNHILIHC 144 >emb|CAN78003.1| hypothetical protein VITISV_008442 [Vitis vinifera] Length = 352 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/45 (55%), Positives = 27/45 (60%) Frame = +2 Query: 104 FFVWLASSGRIFALDCLISHGWITPNFCSLCLRNGESVYHILIHC 238 FF W A+ G+I LD L GW PN C LC ESV HILIHC Sbjct: 302 FFAWEATWGKILTLDRLQKRGWQLPNLCFLCACEAESVNHILIHC 346