BLASTX nr result
ID: Akebia23_contig00038278
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00038278 (406 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518274.1| conserved hypothetical protein [Ricinus comm... 112 5e-23 emb|CAN71465.1| hypothetical protein VITISV_038986 [Vitis vinifera] 78 1e-12 >ref|XP_002518274.1| conserved hypothetical protein [Ricinus communis] gi|223542494|gb|EEF44034.1| conserved hypothetical protein [Ricinus communis] Length = 431 Score = 112 bits (280), Expect = 5e-23 Identities = 51/55 (92%), Positives = 53/55 (96%) Frame = -3 Query: 362 YVTSSRPRCIEEYLCTMFRLTDKEDRVGVGVYDVILKYDPGRYMLTMGRKQEPLC 198 Y+TSSRPRCIEEYLCTMFR TDKEDRV VGVY+VILKYDPGRYMLTMGRKQEPLC Sbjct: 376 YITSSRPRCIEEYLCTMFRFTDKEDRVRVGVYNVILKYDPGRYMLTMGRKQEPLC 430 >emb|CAN71465.1| hypothetical protein VITISV_038986 [Vitis vinifera] Length = 564 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +1 Query: 301 VSRNIVHRYSSMQRGRDDVTYYDHVQKCCPSARQY 405 V+RNIVHRYSSMQRGRDDVTYYDHVQKCCPSARQY Sbjct: 342 VNRNIVHRYSSMQRGRDDVTYYDHVQKCCPSARQY 376 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +2 Query: 32 EPKIPPTDRSTPITPRTVQDSYHLSYGFLT 121 +PKIPPTDRSTPITPRTVQDSYHLSYG+L+ Sbjct: 298 QPKIPPTDRSTPITPRTVQDSYHLSYGWLS 327