BLASTX nr result
ID: Akebia23_contig00038093
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00038093 (328 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007225695.1| hypothetical protein PRUPE_ppa004967mg [Prun... 55 8e-06 >ref|XP_007225695.1| hypothetical protein PRUPE_ppa004967mg [Prunus persica] gi|462422631|gb|EMJ26894.1| hypothetical protein PRUPE_ppa004967mg [Prunus persica] Length = 483 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -3 Query: 323 NCQGYLGAKRKTDKVDLCWGSKRRRSSKVLVEII 222 NCQGYLG+KRK KV+LCWGSKR+R+S + II Sbjct: 448 NCQGYLGSKRKIHKVELCWGSKRKRTSTACIAII 481