BLASTX nr result
ID: Akebia23_contig00037954
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00037954 (267 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF16005.1| hypothetical protein SEPMUDRAFT_124141 [Sphaeruli... 77 3e-12 gb|EME77953.1| hypothetical protein MYCFIDRAFT_168518 [Pseudocer... 70 2e-10 ref|XP_001930668.1| hypothetical protein PTRG_00335 [Pyrenophora... 61 1e-07 gb|EPS42146.1| hypothetical protein H072_3888 [Dactylellina hapt... 59 7e-07 gb|EUN31819.1| hypothetical protein COCVIDRAFT_33754 [Bipolaris ... 57 2e-06 gb|EUC29723.1| hypothetical protein COCCADRAFT_39940 [Bipolaris ... 57 2e-06 ref|XP_003848543.1| hypothetical protein MYCGRDRAFT_88109 [Zymos... 55 8e-06 ref|XP_003307019.1| hypothetical protein PTT_20340 [Pyrenophora ... 55 8e-06 >gb|EMF16005.1| hypothetical protein SEPMUDRAFT_124141 [Sphaerulina musiva SO2202] Length = 88 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -2 Query: 266 KEQAKGNTPNSGLGDRISGATGAVSDKLSQEKHEGSASVNKESI 135 KEQAKGNTPNS +GDR+SGATGA+SDKL Q KHEG+AS NK SI Sbjct: 45 KEQAKGNTPNSSIGDRVSGATGAISDKLDQTKHEGAASANKHSI 88 >gb|EME77953.1| hypothetical protein MYCFIDRAFT_168518 [Pseudocercospora fijiensis CIRAD86] Length = 88 Score = 70.5 bits (171), Expect = 2e-10 Identities = 34/44 (77%), Positives = 36/44 (81%) Frame = -2 Query: 266 KEQAKGNTPNSGLGDRISGATGAVSDKLSQEKHEGSASVNKESI 135 KEQAKGNTPN+ +GDRISGA GAV DKL Q KHE SA NKESI Sbjct: 45 KEQAKGNTPNNTIGDRISGAAGAVGDKLDQTKHETSAKANKESI 88 >ref|XP_001930668.1| hypothetical protein PTRG_00335 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187972274|gb|EDU39773.1| hypothetical protein PTRG_00335 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 89 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/45 (68%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = -2 Query: 266 KEQAKGNTP-NSGLGDRISGATGAVSDKLSQEKHEGSASVNKESI 135 K+QAKGN P N + DR SGA GA DKLSQEKHEGSA NK SI Sbjct: 45 KQQAKGNVPGNDSITDRASGALGAAGDKLSQEKHEGSAEANKRSI 89 >gb|EPS42146.1| hypothetical protein H072_3888 [Dactylellina haptotyla CBS 200.50] Length = 89 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = -2 Query: 266 KEQAKGNTP-NSGLGDRISGATGAVSDKLSQEKHEGSASVNKESI 135 KEQAKGN P N +GDR+SGA GA SDK+ Q K+E A NKESI Sbjct: 45 KEQAKGNVPGNDSIGDRVSGALGAASDKVDQHKYETGAKANKESI 89 >gb|EUN31819.1| hypothetical protein COCVIDRAFT_33754 [Bipolaris victoriae FI3] Length = 322 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = -2 Query: 266 KEQAKGNTPNS-GLGDRISGATGAVSDKLSQEKHEGSASVNKESI 135 K+QAKGN P +GDRISG A SDK++QEKH+G+A NK SI Sbjct: 278 KQQAKGNVPGQDSIGDRISGGLNAASDKINQEKHDGAAEANKRSI 322 >gb|EUC29723.1| hypothetical protein COCCADRAFT_39940 [Bipolaris zeicola 26-R-13] Length = 315 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = -2 Query: 266 KEQAKGNTPNS-GLGDRISGATGAVSDKLSQEKHEGSASVNKESI 135 K+QAKGN P +GDRISG A SDK++QEKH+G+A NK SI Sbjct: 271 KQQAKGNVPGQDSIGDRISGGLNAASDKINQEKHDGAAEANKRSI 315 >ref|XP_003848543.1| hypothetical protein MYCGRDRAFT_88109 [Zymoseptoria tritici IPO323] gi|339468418|gb|EGP83519.1| hypothetical protein MYCGRDRAFT_88109 [Zymoseptoria tritici IPO323] Length = 89 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/45 (60%), Positives = 31/45 (68%), Gaps = 1/45 (2%) Frame = -2 Query: 266 KEQAKGNTP-NSGLGDRISGATGAVSDKLSQEKHEGSASVNKESI 135 KEQAKGN P N+ + DR+SGA GA SDK Q KHE S NK+ I Sbjct: 45 KEQAKGNVPGNNSITDRVSGALGAASDKAEQSKHEASKEANKQGI 89 >ref|XP_003307019.1| hypothetical protein PTT_20340 [Pyrenophora teres f. teres 0-1] gi|311315198|gb|EFQ84906.1| hypothetical protein PTT_20340 [Pyrenophora teres f. teres 0-1] Length = 303 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/45 (60%), Positives = 31/45 (68%), Gaps = 1/45 (2%) Frame = -2 Query: 266 KEQAKGNTP-NSGLGDRISGATGAVSDKLSQEKHEGSASVNKESI 135 K+QAKGN P N + DR SGA A DK+ QEKHEG+A NK SI Sbjct: 259 KQQAKGNVPGNDSITDRASGALNAAGDKMKQEKHEGAAEANKRSI 303