BLASTX nr result
ID: Akebia23_contig00035313
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00035313 (273 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EFY89827.1| DUF821 domain-containing protein [Metarhizium acr... 67 3e-09 gb|EKG14198.1| Lipopolysaccharide-modifying protein [Macrophomin... 65 8e-09 gb|EFZ04343.1| DUF821 domain-containing protein [Metarhizium ani... 65 1e-08 gb|EON69768.1| hypothetical protein W97_09031 [Coniosporium apol... 64 2e-08 ref|XP_007583425.1| putative duf821 domain-containing protein [N... 61 2e-07 gb|EMF16398.1| hypothetical protein SEPMUDRAFT_145659 [Sphaeruli... 59 7e-07 gb|EON62724.1| hypothetical protein W97_01948 [Coniosporium apol... 58 1e-06 gb|EOA89795.1| hypothetical protein SETTUDRAFT_167565 [Setosphae... 57 3e-06 gb|EXJ90583.1| hypothetical protein A1O1_03686 [Capronia coronat... 56 6e-06 ref|XP_003171561.1| DUF821 domain-containing protein [Arthroderm... 56 6e-06 gb|EXJ89791.1| hypothetical protein A1O3_02858 [Capronia epimyce... 55 8e-06 ref|XP_003857305.1| hypothetical protein MYCGRDRAFT_24570, parti... 55 8e-06 >gb|EFY89827.1| DUF821 domain-containing protein [Metarhizium acridum CQMa 102] Length = 463 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/64 (48%), Positives = 39/64 (60%) Frame = -2 Query: 272 YLTPAAQACYWRKLFNTWSSVSYEPELYRTTKDSLGKVRRRSRGTPFETFVAAMVMPAD* 93 YLTPA+Q CYWR+L W+SVS+EP+L+ KD R RG PFETFV + P Sbjct: 403 YLTPASQVCYWRELLRGWASVSFEPQLWNVDKDG---ARTTMRGVPFETFVPSWCSPRPR 459 Query: 92 ATTG 81 + G Sbjct: 460 SVNG 463 >gb|EKG14198.1| Lipopolysaccharide-modifying protein [Macrophomina phaseolina MS6] Length = 441 Score = 65.5 bits (158), Expect = 8e-09 Identities = 32/51 (62%), Positives = 36/51 (70%) Frame = -2 Query: 272 YLTPAAQACYWRKLFNTWSSVSYEPELYRTTKDSLGKVRRRSRGTPFETFV 120 YLTPAAQACYWRK+F TWS VS+EPEL + GK RG PFET+V Sbjct: 382 YLTPAAQACYWRKMFRTWSEVSFEPEL----SEDYGK----PRGIPFETYV 424 >gb|EFZ04343.1| DUF821 domain-containing protein [Metarhizium anisopliae ARSEF 23] gi|594712505|gb|EXU95468.1| glycosyl transferase family 90 protein [Metarhizium robertsii] Length = 468 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/51 (56%), Positives = 35/51 (68%) Frame = -2 Query: 272 YLTPAAQACYWRKLFNTWSSVSYEPELYRTTKDSLGKVRRRSRGTPFETFV 120 YLTPA+Q CYWR+L W+SVS+EP+L+ KD R RG PFETFV Sbjct: 400 YLTPASQVCYWRELLRGWASVSFEPQLWNVDKDG---ARTTMRGVPFETFV 447 >gb|EON69768.1| hypothetical protein W97_09031 [Coniosporium apollinis CBS 100218] Length = 401 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/51 (54%), Positives = 37/51 (72%) Frame = -2 Query: 272 YLTPAAQACYWRKLFNTWSSVSYEPELYRTTKDSLGKVRRRSRGTPFETFV 120 YLTPAAQACYWRKLF W++ S+EPE+Y+ K+ + RG PFET++ Sbjct: 357 YLTPAAQACYWRKLFEVWAAHSFEPEMYQKGKEKVW------RGIPFETYM 401 >ref|XP_007583425.1| putative duf821 domain-containing protein [Neofusicoccum parvum UCRNP2] gi|485924212|gb|EOD49101.1| putative duf821 domain-containing protein [Neofusicoccum parvum UCRNP2] Length = 431 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/51 (58%), Positives = 34/51 (66%) Frame = -2 Query: 272 YLTPAAQACYWRKLFNTWSSVSYEPELYRTTKDSLGKVRRRSRGTPFETFV 120 YLTPAAQACYWRKLF W VS+EPEL + GK RG PFET++ Sbjct: 389 YLTPAAQACYWRKLFRMWRDVSFEPEL----SEDYGK----PRGIPFETYM 431 >gb|EMF16398.1| hypothetical protein SEPMUDRAFT_145659 [Sphaerulina musiva SO2202] Length = 470 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/53 (49%), Positives = 36/53 (67%), Gaps = 2/53 (3%) Frame = -2 Query: 272 YLTPAAQACYWRKLFNTWSSVSYEPELYRTTKD--SLGKVRRRSRGTPFETFV 120 Y TPAA ACYWRKL TWS+V++EP+++ + D + R+R RG FE F+ Sbjct: 399 YTTPAATACYWRKLMRTWSTVAFEPQIHIPSDDEETSSSPRKRIRGITFEEFI 451 >gb|EON62724.1| hypothetical protein W97_01948 [Coniosporium apollinis CBS 100218] Length = 420 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/50 (48%), Positives = 37/50 (74%) Frame = -2 Query: 272 YLTPAAQACYWRKLFNTWSSVSYEPELYRTTKDSLGKVRRRSRGTPFETF 123 +L+PAAQACYWR++ +W++VS+ PE + + + GK R+ RG PFE+F Sbjct: 371 FLSPAAQACYWRRMIESWATVSFVPEGWEVVR-TKGKEMRKLRGVPFESF 419 >gb|EOA89795.1| hypothetical protein SETTUDRAFT_167565 [Setosphaeria turcica Et28A] Length = 432 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/53 (52%), Positives = 35/53 (66%), Gaps = 1/53 (1%) Frame = -2 Query: 272 YLTPAAQACYWRKLFNTWSSV-SYEPELYRTTKDSLGKVRRRSRGTPFETFVA 117 YLTPAA CYWR+LF W+SV Y+P+LY T KD ++ RGTP+ F A Sbjct: 374 YLTPAAVTCYWRRLFWAWASVQGYDPQLYDTGKDG----KKVIRGTPWTAFAA 422 >gb|EXJ90583.1| hypothetical protein A1O1_03686 [Capronia coronata CBS 617.96] Length = 416 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/51 (49%), Positives = 33/51 (64%) Frame = -2 Query: 272 YLTPAAQACYWRKLFNTWSSVSYEPELYRTTKDSLGKVRRRSRGTPFETFV 120 YLTPAA+ CYWRKLF+ WS VS+EPE + ++ RG P E+F+ Sbjct: 361 YLTPAAEVCYWRKLFHGWSQVSFEPEFFEVVDG-----QKVWRGLPVESFL 406 >ref|XP_003171561.1| DUF821 domain-containing protein [Arthroderma gypseum CBS 118893] gi|311343904|gb|EFR03107.1| DUF821 domain-containing protein [Arthroderma gypseum CBS 118893] Length = 422 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/51 (47%), Positives = 33/51 (64%) Frame = -2 Query: 272 YLTPAAQACYWRKLFNTWSSVSYEPELYRTTKDSLGKVRRRSRGTPFETFV 120 YLTPAA+ACYWR L +W+ VS+EPE +R ++ RG P E+F+ Sbjct: 367 YLTPAAEACYWRHLIRSWAEVSFEPEFFREADG-----KKVGRGVPVESFL 412 >gb|EXJ89791.1| hypothetical protein A1O3_02858 [Capronia epimyces CBS 606.96] Length = 427 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/51 (49%), Positives = 34/51 (66%) Frame = -2 Query: 272 YLTPAAQACYWRKLFNTWSSVSYEPELYRTTKDSLGKVRRRSRGTPFETFV 120 YLTPAA+ACYWRKL + W+SVS+EPE + ++ RG P E+F+ Sbjct: 372 YLTPAAEACYWRKLIHGWASVSFEPEFFEIVDG-----KKIWRGLPVESFM 417 >ref|XP_003857305.1| hypothetical protein MYCGRDRAFT_24570, partial [Zymoseptoria tritici IPO323] gi|339477190|gb|EGP92281.1| hypothetical protein MYCGRDRAFT_24570 [Zymoseptoria tritici IPO323] Length = 362 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/51 (52%), Positives = 33/51 (64%) Frame = -2 Query: 272 YLTPAAQACYWRKLFNTWSSVSYEPELYRTTKDSLGKVRRRSRGTPFETFV 120 Y TPAA ACYWRKL WS+V++EP++ TK K R RGT FE F+ Sbjct: 316 YTTPAATACYWRKLMRAWSTVAFEPKVIDETK----KGTIRLRGTSFEEFM 362