BLASTX nr result
ID: Akebia23_contig00035133
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00035133 (252 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32361.1| hypothetical protein MIMGU_mgv1a024637mg [Mimulus... 59 9e-07 ref|XP_003578833.1| PREDICTED: probable anion transporter 7-like... 57 2e-06 ref|XP_004982440.1| PREDICTED: probable anion transporter 7-like... 56 6e-06 dbj|BAK07905.1| predicted protein [Hordeum vulgare subsp. vulgare] 56 6e-06 gb|EXC02648.1| putative anion transporter 5 [Morus notabilis] 55 8e-06 >gb|EYU32361.1| hypothetical protein MIMGU_mgv1a024637mg [Mimulus guttatus] Length = 427 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +2 Query: 158 MRRIIFPKRYVIVFLTFICTCVCYIERVGFS 250 M+ I PKRYVIV LTFICTCVCYIERVGFS Sbjct: 1 MKSISLPKRYVIVMLTFICTCVCYIERVGFS 31 >ref|XP_003578833.1| PREDICTED: probable anion transporter 7-like [Brachypodium distachyon] Length = 436 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 158 MRRIIFPKRYVIVFLTFICTCVCYIERVGFS 250 M R+ FP+RYVIVFLTFICT VCYIERVGFS Sbjct: 1 MARLKFPRRYVIVFLTFICTNVCYIERVGFS 31 >ref|XP_004982440.1| PREDICTED: probable anion transporter 7-like isoform X1 [Setaria italica] gi|514815368|ref|XP_004982441.1| PREDICTED: probable anion transporter 7-like isoform X2 [Setaria italica] Length = 436 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +2 Query: 158 MRRIIFPKRYVIVFLTFICTCVCYIERVGFS 250 M R+ FPKRYVIV LTFICT VCYIERVGFS Sbjct: 1 MMRMKFPKRYVIVLLTFICTNVCYIERVGFS 31 >dbj|BAK07905.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 438 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 155 IMRRIIFPKRYVIVFLTFICTCVCYIERVGFS 250 +M+R+ PKRYVIV LTFICT VCYIERVGFS Sbjct: 2 VMKRMKIPKRYVIVLLTFICTNVCYIERVGFS 33 >gb|EXC02648.1| putative anion transporter 5 [Morus notabilis] Length = 443 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +2 Query: 158 MRRIIFPKRYVIVFLTFICTCVCYIERVGFS 250 MR + FPKRY+IV LTFICT VCYIERVGFS Sbjct: 1 MRMMKFPKRYLIVILTFICTSVCYIERVGFS 31