BLASTX nr result
ID: Akebia23_contig00034087
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00034087 (486 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006845969.1| hypothetical protein AMTR_s03506p00006730, p... 77 2e-12 gb|AEK71755.1| hypothetical chloroplast RF1 [Ficus sp. M. J. Moo... 77 2e-12 gb|AEK71451.1| hypothetical chloroplast RF1 [Celtis occidentalis] 77 2e-12 gb|AEK71444.1| hypothetical chloroplast RF1 [Ceanothus prostratus] 77 2e-12 gb|ADD30916.1| putative RF1 protein [Ficus sp. Moore 315] 77 2e-12 gb|ACN74144.1| hypothetical protein [Cischweinfia sp. Whitten 2461] 77 2e-12 ref|YP_762318.1| hypothetical chloroplast RF1 [Morus indica] gi|... 77 2e-12 gb|AEK71605.1| hypothetical chloroplast RF1 [Ehretia acuminata] 77 3e-12 gb|ADD30905.1| putative RF1 protein [Ehretia acuminata] 77 3e-12 gb|ACN74000.1| hypothetical protein [Leochilus inconspicuus] 77 3e-12 gb|ACN73990.1| hypothetical protein [Leochilus inconspicuus] 77 3e-12 ref|YP_008999990.1| hypothetical chloroplast RF19 (chloroplast) ... 76 4e-12 ref|YP_005089389.1| ycf1 gene product (chloroplast) [Silene vulg... 76 4e-12 ref|YP_005089632.1| ycf1 gene product (chloroplast) [Silene lati... 76 4e-12 gb|AEK78274.1| hypothetical chloroplast RF1 [Rivina humilis] 76 4e-12 gb|AEK78254.1| hypothetical chloroplast RF1 [Phaulothamnus spine... 76 4e-12 gb|AEK78187.1| hypothetical chloroplast RF1 [Gisekia africana] 76 4e-12 gb|AGM15031.1| Ycf1 (chloroplast) [Panax ginseng] gi|506444557|g... 76 6e-12 gb|AHE41716.1| Ycf1, partial (chloroplast) [Ribes fasciculatum v... 76 6e-12 gb|AHE41714.1| Ycf1, partial (chloroplast) [Philadelphus coronar... 76 6e-12 >ref|XP_006845969.1| hypothetical protein AMTR_s03506p00006730, partial [Amborella trichopoda] gi|548848703|gb|ERN07644.1| hypothetical protein AMTR_s03506p00006730, partial [Amborella trichopoda] Length = 302 Score = 77.0 bits (188), Expect = 2e-12 Identities = 38/48 (79%), Positives = 39/48 (81%) Frame = +2 Query: 200 TNRNSMCNLSIYCVFLNKLICQ*FNHFILPSSMFS*ISNIYMFRCNNK 343 TNRNSM NLSI CVFLN LI Q FNHFILPSSM + NIYMFRCNNK Sbjct: 104 TNRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLVRLVNIYMFRCNNK 151 >gb|AEK71755.1| hypothetical chloroplast RF1 [Ficus sp. M. J. Moore 315] Length = 315 Score = 77.0 bits (188), Expect = 2e-12 Identities = 38/48 (79%), Positives = 39/48 (81%) Frame = +2 Query: 200 TNRNSMCNLSIYCVFLNKLICQ*FNHFILPSSMFS*ISNIYMFRCNNK 343 TNRNSM NLSI CVFLN LI Q FNHFILPSSM + NIYMFRCNNK Sbjct: 116 TNRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLVRLVNIYMFRCNNK 163 >gb|AEK71451.1| hypothetical chloroplast RF1 [Celtis occidentalis] Length = 249 Score = 77.0 bits (188), Expect = 2e-12 Identities = 38/48 (79%), Positives = 39/48 (81%) Frame = +2 Query: 200 TNRNSMCNLSIYCVFLNKLICQ*FNHFILPSSMFS*ISNIYMFRCNNK 343 TNRNSM NLSI CVFLN LI Q FNHFILPSSM + NIYMFRCNNK Sbjct: 118 TNRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLVRLVNIYMFRCNNK 165 >gb|AEK71444.1| hypothetical chloroplast RF1 [Ceanothus prostratus] Length = 249 Score = 77.0 bits (188), Expect = 2e-12 Identities = 38/48 (79%), Positives = 39/48 (81%) Frame = +2 Query: 200 TNRNSMCNLSIYCVFLNKLICQ*FNHFILPSSMFS*ISNIYMFRCNNK 343 TNRNSM NLSI CVFLN LI Q FNHFILPSSM + NIYMFRCNNK Sbjct: 118 TNRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLVRLVNIYMFRCNNK 165 >gb|ADD30916.1| putative RF1 protein [Ficus sp. Moore 315] Length = 1877 Score = 77.0 bits (188), Expect = 2e-12 Identities = 38/48 (79%), Positives = 39/48 (81%) Frame = +2 Query: 200 TNRNSMCNLSIYCVFLNKLICQ*FNHFILPSSMFS*ISNIYMFRCNNK 343 TNRNSM NLSI CVFLN LI Q FNHFILPSSM + NIYMFRCNNK Sbjct: 116 TNRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLVRLVNIYMFRCNNK 163 >gb|ACN74144.1| hypothetical protein [Cischweinfia sp. Whitten 2461] Length = 351 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/48 (75%), Positives = 39/48 (81%) Frame = +2 Query: 200 TNRNSMCNLSIYCVFLNKLICQ*FNHFILPSSMFS*ISNIYMFRCNNK 343 T RNSM NLSI CVFLN LICQ FNHFI+PSS + + NIYMFRCNNK Sbjct: 98 TTRNSMRNLSIQCVFLNNLICQLFNHFIIPSSTLARLVNIYMFRCNNK 145 >ref|YP_762318.1| hypothetical chloroplast RF1 [Morus indica] gi|118574756|sp|Q09WW0.1|YCF1_MORIN RecName: Full=Putative membrane protein ycf1; Short=RF1 gi|78100373|gb|ABB21014.1| hypothetical chloroplast RF1 [Morus indica] Length = 1879 Score = 77.0 bits (188), Expect = 2e-12 Identities = 38/48 (79%), Positives = 39/48 (81%) Frame = +2 Query: 200 TNRNSMCNLSIYCVFLNKLICQ*FNHFILPSSMFS*ISNIYMFRCNNK 343 TNRNSM NLSI CVFLN LI Q FNHFILPSSM + NIYMFRCNNK Sbjct: 119 TNRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLVRLVNIYMFRCNNK 166 >gb|AEK71605.1| hypothetical chloroplast RF1 [Ehretia acuminata] Length = 351 Score = 76.6 bits (187), Expect = 3e-12 Identities = 39/57 (68%), Positives = 42/57 (73%) Frame = +2 Query: 200 TNRNSMCNLSIYCVFLNKLICQ*FNHFILPSSMFS*ISNIYMFRCNNK*VVTLPYFL 370 T RNSM NLSI CVFLN LI Q FNHFILPSSM + + NIYMFRCNNK + FL Sbjct: 113 TTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLARLVNIYMFRCNNKMLFVTSSFL 169 >gb|ADD30905.1| putative RF1 protein [Ehretia acuminata] Length = 1814 Score = 76.6 bits (187), Expect = 3e-12 Identities = 39/57 (68%), Positives = 42/57 (73%) Frame = +2 Query: 200 TNRNSMCNLSIYCVFLNKLICQ*FNHFILPSSMFS*ISNIYMFRCNNK*VVTLPYFL 370 T RNSM NLSI CVFLN LI Q FNHFILPSSM + + NIYMFRCNNK + FL Sbjct: 113 TTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLARLVNIYMFRCNNKMLFVTSSFL 169 >gb|ACN74000.1| hypothetical protein [Leochilus inconspicuus] Length = 351 Score = 76.6 bits (187), Expect = 3e-12 Identities = 38/48 (79%), Positives = 39/48 (81%) Frame = +2 Query: 200 TNRNSMCNLSIYCVFLNKLICQ*FNHFILPSSMFS*ISNIYMFRCNNK 343 TNRNSM NLSI CVFLN LI Q FNHFILPSS + I NIYMFRCNNK Sbjct: 98 TNRNSMRNLSIQCVFLNNLIFQLFNHFILPSSTLARIVNIYMFRCNNK 145 >gb|ACN73990.1| hypothetical protein [Leochilus inconspicuus] Length = 352 Score = 76.6 bits (187), Expect = 3e-12 Identities = 38/48 (79%), Positives = 39/48 (81%) Frame = +2 Query: 200 TNRNSMCNLSIYCVFLNKLICQ*FNHFILPSSMFS*ISNIYMFRCNNK 343 TNRNSM NLSI CVFLN LI Q FNHFILPSS + I NIYMFRCNNK Sbjct: 98 TNRNSMRNLSIQCVFLNNLIFQLFNHFILPSSTLARIVNIYMFRCNNK 145 >ref|YP_008999990.1| hypothetical chloroplast RF19 (chloroplast) [Agrostemma githago] gi|555944077|gb|AGZ17981.1| hypothetical chloroplast RF19 (chloroplast) [Agrostemma githago] Length = 1856 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = +2 Query: 200 TNRNSMCNLSIYCVFLNKLICQ*FNHFILPSSMFS*ISNIYMFRCNNK 343 T+RNSM NLSI CVFLN LI Q FNHFILPSSM + + NIYMFRCNNK Sbjct: 118 TSRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLARLVNIYMFRCNNK 165 >ref|YP_005089389.1| ycf1 gene product (chloroplast) [Silene vulgaris] gi|329755742|gb|AEC04303.1| hypothetical chloroplast RF19 (chloroplast) [Silene vulgaris] Length = 1883 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = +2 Query: 200 TNRNSMCNLSIYCVFLNKLICQ*FNHFILPSSMFS*ISNIYMFRCNNK 343 T+RNSM NLSI CVFLN LI Q FNHFILPSSM + + NIYMFRCNNK Sbjct: 119 TSRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLARLVNIYMFRCNNK 166 >ref|YP_005089632.1| ycf1 gene product (chloroplast) [Silene latifolia] gi|329755577|gb|AEC04140.1| hypothetical chloroplast RF19 (chloroplast) [Silene latifolia] Length = 1883 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = +2 Query: 200 TNRNSMCNLSIYCVFLNKLICQ*FNHFILPSSMFS*ISNIYMFRCNNK 343 T+RNSM NLSI CVFLN LI Q FNHFILPSSM + + NIYMFRCNNK Sbjct: 119 TSRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLARLVNIYMFRCNNK 166 >gb|AEK78274.1| hypothetical chloroplast RF1 [Rivina humilis] Length = 194 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = +2 Query: 200 TNRNSMCNLSIYCVFLNKLICQ*FNHFILPSSMFS*ISNIYMFRCNNK 343 T+RNSM NLSI CVFLN LI Q FNHFILPSSM + + NIYMFRCNNK Sbjct: 119 TSRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLARLVNIYMFRCNNK 166 >gb|AEK78254.1| hypothetical chloroplast RF1 [Phaulothamnus spinescens] Length = 212 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = +2 Query: 200 TNRNSMCNLSIYCVFLNKLICQ*FNHFILPSSMFS*ISNIYMFRCNNK 343 T+RNSM NLSI CVFLN LI Q FNHFILPSSM + + NIYMFRCNNK Sbjct: 119 TSRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLARLVNIYMFRCNNK 166 >gb|AEK78187.1| hypothetical chloroplast RF1 [Gisekia africana] Length = 212 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = +2 Query: 200 TNRNSMCNLSIYCVFLNKLICQ*FNHFILPSSMFS*ISNIYMFRCNNK 343 T+RNSM NLSI CVFLN LI Q FNHFILPSSM + + NIYMFRCNNK Sbjct: 119 TSRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLARLVNIYMFRCNNK 166 >gb|AGM15031.1| Ycf1 (chloroplast) [Panax ginseng] gi|506444557|gb|AGM15117.1| Ycf1 (chloroplast) [Panax ginseng] gi|506444673|gb|AGM15203.1| Ycf1 (chloroplast) [Panax ginseng] Length = 1919 Score = 75.9 bits (185), Expect = 6e-12 Identities = 37/48 (77%), Positives = 39/48 (81%) Frame = +2 Query: 200 TNRNSMCNLSIYCVFLNKLICQ*FNHFILPSSMFS*ISNIYMFRCNNK 343 T RNSM NLSI CVFLN LI Q FNHFILPSSM + + NIYMFRCNNK Sbjct: 119 TTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLARLVNIYMFRCNNK 166 >gb|AHE41716.1| Ycf1, partial (chloroplast) [Ribes fasciculatum var. chinense] Length = 195 Score = 75.9 bits (185), Expect = 6e-12 Identities = 37/48 (77%), Positives = 39/48 (81%) Frame = +2 Query: 200 TNRNSMCNLSIYCVFLNKLICQ*FNHFILPSSMFS*ISNIYMFRCNNK 343 T RNSM NLSI CVFLN LI Q FNHFILPSSM + + NIYMFRCNNK Sbjct: 98 TTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLARLVNIYMFRCNNK 145 >gb|AHE41714.1| Ycf1, partial (chloroplast) [Philadelphus coronarius] Length = 193 Score = 75.9 bits (185), Expect = 6e-12 Identities = 37/48 (77%), Positives = 39/48 (81%) Frame = +2 Query: 200 TNRNSMCNLSIYCVFLNKLICQ*FNHFILPSSMFS*ISNIYMFRCNNK 343 T RNSM NLSI CVFLN LI Q FNHFILPSSM + + NIYMFRCNNK Sbjct: 96 TTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLARLVNIYMFRCNNK 143