BLASTX nr result
ID: Akebia23_contig00033878
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00033878 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON64977.1| hypothetical protein W97_04212 [Coniosporium apol... 60 3e-07 >gb|EON64977.1| hypothetical protein W97_04212 [Coniosporium apollinis CBS 100218] Length = 70 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/58 (48%), Positives = 37/58 (63%) Frame = +1 Query: 109 HATSEDRARRTSGEKFIGLTQQKRDPALPNAAERKASLQEQAPKPGVLGEMWNKTFKG 282 + + DR R + KF L KRDPA NAA+R++S +QA KPGVLG+MWN +G Sbjct: 8 NGANSDRRRSSGATKFANLHAFKRDPANDNAAQRRSSFADQAQKPGVLGQMWNNWTRG 65