BLASTX nr result
ID: Akebia23_contig00033737
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00033737 (267 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETS79391.1| hypothetical protein PFICI_09244 [Pestalotiopsis ... 70 2e-10 >gb|ETS79391.1| hypothetical protein PFICI_09244 [Pestalotiopsis fici W106-1] Length = 358 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/49 (67%), Positives = 37/49 (75%), Gaps = 1/49 (2%) Frame = -1 Query: 150 MSTTDNSATPLKKDKGPSTNGGEQTVV-FRPQQNMIVEPPRQEDLQPSY 7 MS TDNS+ PL+KDKGP TNG + FRPQQNM VEPP+ DLQPSY Sbjct: 1 MSATDNSSAPLRKDKGPETNGASDGHIGFRPQQNMTVEPPKPRDLQPSY 49