BLASTX nr result
ID: Akebia23_contig00033709
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00033709 (335 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON68870.1| hypothetical protein W97_08128 [Coniosporium apol... 63 5e-08 >gb|EON68870.1| hypothetical protein W97_08128 [Coniosporium apollinis CBS 100218] Length = 438 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/56 (48%), Positives = 42/56 (75%) Frame = +1 Query: 1 MSRTPRTLNESRPESPTSADESSGDRSPNVESSRGRKGRHVQDEVDAQMKGEMKTK 168 M+R+ R LN+SRP+SP S+++ S D + + RGR+G+++QDEVDAQ+ EM T+ Sbjct: 382 MTRSRRNLNDSRPQSPNSSEDGSDDHKDSADVPRGRRGKNIQDEVDAQVVEEMDTR 437