BLASTX nr result
ID: Akebia23_contig00033586
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00033586 (205 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007223083.1| hypothetical protein PRUPE_ppa006990mg [Prun... 59 9e-07 gb|EXB38629.1| hypothetical protein L484_014443 [Morus notabilis] 56 6e-06 >ref|XP_007223083.1| hypothetical protein PRUPE_ppa006990mg [Prunus persica] gi|462420019|gb|EMJ24282.1| hypothetical protein PRUPE_ppa006990mg [Prunus persica] Length = 387 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/44 (63%), Positives = 37/44 (84%) Frame = -1 Query: 133 MNIGESVRN*TDFSLEITKRVMLEEGKESNLVFSPLSIHVVLSL 2 M++ ES+RN D +L +TK+++ EGKESNLV+SPLSIHVVLSL Sbjct: 1 MDLRESIRNQNDVALGLTKKLLQTEGKESNLVYSPLSIHVVLSL 44 >gb|EXB38629.1| hypothetical protein L484_014443 [Morus notabilis] Length = 390 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/44 (59%), Positives = 36/44 (81%) Frame = -1 Query: 133 MNIGESVRN*TDFSLEITKRVMLEEGKESNLVFSPLSIHVVLSL 2 M++ E++ + TD +L +TK ++ EGK+SNLVFSPLSIHVVLSL Sbjct: 1 MDVRETITSLTDVALSVTKHLLQTEGKDSNLVFSPLSIHVVLSL 44