BLASTX nr result
ID: Akebia23_contig00033564
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00033564 (231 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC97516.1| hypothetical protein BAUCODRAFT_33231 [Baudoinia ... 97 2e-18 ref|XP_007585008.1| putative upf0591 membrane protein [Neofusico... 95 9e-18 gb|EHK99687.1| putative UPF0591 membrane protein C15E1.02c [Glar... 94 3e-17 gb|EME44501.1| hypothetical protein DOTSEDRAFT_72092 [Dothistrom... 93 3e-17 gb|EOA92208.1| hypothetical protein SETTUDRAFT_18855 [Setosphaer... 93 4e-17 gb|ELR06076.1| hypothetical protein GMDG_07787 [Pseudogymnoascus... 93 4e-17 ref|XP_003302522.1| hypothetical protein PTT_14363 [Pyrenophora ... 93 4e-17 ref|XP_001795230.1| hypothetical protein SNOG_04817 [Phaeosphaer... 93 4e-17 gb|EUC43785.1| hypothetical protein COCMIDRAFT_27772 [Bipolaris ... 92 6e-17 gb|EMF08657.1| DUF1761-domain-containing protein [Sphaerulina mu... 92 6e-17 gb|EMD96540.1| hypothetical protein COCHEDRAFT_1199471 [Bipolari... 92 6e-17 gb|EMD68350.1| hypothetical protein COCSADRAFT_33280 [Bipolaris ... 92 6e-17 ref|XP_007295995.1| hypothetical protein MBM_08106 [Marssonina b... 92 8e-17 ref|XP_003847889.1| hypothetical protein MYCGRDRAFT_106289 [Zymo... 92 1e-16 ref|XP_001934443.1| hypothetical protein PTRG_04110 [Pyrenophora... 92 1e-16 ref|XP_001588152.1| hypothetical protein SS1G_10598 [Sclerotinia... 92 1e-16 gb|EON68842.1| hypothetical protein W97_08100 [Coniosporium apol... 91 1e-16 gb|EME84222.1| hypothetical protein MYCFIDRAFT_163055 [Pseudocer... 91 1e-16 gb|EEH22507.1| conserved hypothetical protein [Paracoccidioides ... 91 1e-16 ref|XP_001557524.1| hypothetical protein BC1G_04134 [Botryotinia... 91 1e-16 >gb|EMC97516.1| hypothetical protein BAUCODRAFT_33231 [Baudoinia compniacensis UAMH 10762] Length = 153 Score = 97.4 bits (241), Expect = 2e-18 Identities = 45/54 (83%), Positives = 52/54 (96%) Frame = +2 Query: 68 MASLSYLPPVKPSAIAVGTAFNHLASLAILGPVFGDTYRQAQAANSKEEFFKSK 229 MA+L YLPPVKPSA+A+GT FNH+ASLAILGPVFG+TYRQAQ+AN+KEEFFKSK Sbjct: 1 MATLHYLPPVKPSAVALGTVFNHVASLAILGPVFGETYRQAQSANTKEEFFKSK 54 >ref|XP_007585008.1| putative upf0591 membrane protein [Neofusicoccum parvum UCRNP2] gi|485921883|gb|EOD47496.1| putative upf0591 membrane protein [Neofusicoccum parvum UCRNP2] Length = 151 Score = 95.1 bits (235), Expect = 9e-18 Identities = 44/54 (81%), Positives = 49/54 (90%) Frame = +2 Query: 68 MASLSYLPPVKPSAIAVGTAFNHLASLAILGPVFGDTYRQAQAANSKEEFFKSK 229 MA+L YLPPVKPSAIA+GT +NH SLA+L P+FGDTYRQAQAANSKEEFFKSK Sbjct: 1 MATLHYLPPVKPSAIALGTVYNHAVSLAVLAPIFGDTYRQAQAANSKEEFFKSK 54 >gb|EHK99687.1| putative UPF0591 membrane protein C15E1.02c [Glarea lozoyensis 74030] gi|512200499|gb|EPE29331.1| hypothetical protein GLAREA_00491 [Glarea lozoyensis ATCC 20868] Length = 150 Score = 93.6 bits (231), Expect = 3e-17 Identities = 45/52 (86%), Positives = 48/52 (92%) Frame = +2 Query: 74 SLSYLPPVKPSAIAVGTAFNHLASLAILGPVFGDTYRQAQAANSKEEFFKSK 229 SLSYLPPVKPSAIA+GT FNH ASLAILGPVFGDTY +AQAANSKEEF KS+ Sbjct: 2 SLSYLPPVKPSAIALGTVFNHAASLAILGPVFGDTYHRAQAANSKEEFIKSR 53 >gb|EME44501.1| hypothetical protein DOTSEDRAFT_72092 [Dothistroma septosporum NZE10] Length = 155 Score = 93.2 bits (230), Expect = 3e-17 Identities = 45/52 (86%), Positives = 47/52 (90%) Frame = +2 Query: 74 SLSYLPPVKPSAIAVGTAFNHLASLAILGPVFGDTYRQAQAANSKEEFFKSK 229 SL YLPPVKPSAIA+GT FNH ASLAILGPVFGDTYR+AQ ANS EEFFKSK Sbjct: 2 SLHYLPPVKPSAIALGTVFNHAASLAILGPVFGDTYRRAQQANSSEEFFKSK 53 >gb|EOA92208.1| hypothetical protein SETTUDRAFT_18855 [Setosphaeria turcica Et28A] Length = 151 Score = 92.8 bits (229), Expect = 4e-17 Identities = 44/54 (81%), Positives = 48/54 (88%) Frame = +2 Query: 68 MASLSYLPPVKPSAIAVGTAFNHLASLAILGPVFGDTYRQAQAANSKEEFFKSK 229 MASL YLPPVKPSAIA+GTAFNH SLA+LGPVFGD YR+AQ ANSKEE+F SK Sbjct: 1 MASLHYLPPVKPSAIALGTAFNHAVSLAVLGPVFGDAYRRAQQANSKEEYFHSK 54 >gb|ELR06076.1| hypothetical protein GMDG_07787 [Pseudogymnoascus destructans 20631-21] Length = 150 Score = 92.8 bits (229), Expect = 4e-17 Identities = 45/52 (86%), Positives = 47/52 (90%) Frame = +2 Query: 74 SLSYLPPVKPSAIAVGTAFNHLASLAILGPVFGDTYRQAQAANSKEEFFKSK 229 SL YLPPVKPSAIA+GT FNH ASLAILGPVFGDTY +AQAANSKEEF KSK Sbjct: 2 SLHYLPPVKPSAIALGTVFNHAASLAILGPVFGDTYHRAQAANSKEEFIKSK 53 >ref|XP_003302522.1| hypothetical protein PTT_14363 [Pyrenophora teres f. teres 0-1] gi|311322077|gb|EFQ89381.1| hypothetical protein PTT_14363 [Pyrenophora teres f. teres 0-1] Length = 151 Score = 92.8 bits (229), Expect = 4e-17 Identities = 44/54 (81%), Positives = 48/54 (88%) Frame = +2 Query: 68 MASLSYLPPVKPSAIAVGTAFNHLASLAILGPVFGDTYRQAQAANSKEEFFKSK 229 MASL YLPPVKPSAIA+GTAFNH SLA+LGPVFGD YR+AQ ANSKEE+F SK Sbjct: 1 MASLHYLPPVKPSAIALGTAFNHAVSLAVLGPVFGDAYRRAQQANSKEEYFHSK 54 >ref|XP_001795230.1| hypothetical protein SNOG_04817 [Phaeosphaeria nodorum SN15] gi|111066088|gb|EAT87208.1| hypothetical protein SNOG_04817 [Phaeosphaeria nodorum SN15] Length = 151 Score = 92.8 bits (229), Expect = 4e-17 Identities = 44/54 (81%), Positives = 48/54 (88%) Frame = +2 Query: 68 MASLSYLPPVKPSAIAVGTAFNHLASLAILGPVFGDTYRQAQAANSKEEFFKSK 229 MASL YLPPVKPSAIA+GTAFNH SLA+LGPVFGD YR+AQ ANSKEE+F SK Sbjct: 1 MASLHYLPPVKPSAIALGTAFNHAVSLAVLGPVFGDAYRRAQQANSKEEYFHSK 54 >gb|EUC43785.1| hypothetical protein COCMIDRAFT_27772 [Bipolaris oryzae ATCC 44560] Length = 151 Score = 92.4 bits (228), Expect = 6e-17 Identities = 43/54 (79%), Positives = 48/54 (88%) Frame = +2 Query: 68 MASLSYLPPVKPSAIAVGTAFNHLASLAILGPVFGDTYRQAQAANSKEEFFKSK 229 MASL YLPPVKPSAIA+GTAFNH SLA+LGP+FGD YR+AQ ANSKEE+F SK Sbjct: 1 MASLHYLPPVKPSAIALGTAFNHAVSLAVLGPIFGDAYRRAQQANSKEEYFHSK 54 >gb|EMF08657.1| DUF1761-domain-containing protein [Sphaerulina musiva SO2202] Length = 154 Score = 92.4 bits (228), Expect = 6e-17 Identities = 44/52 (84%), Positives = 47/52 (90%) Frame = +2 Query: 74 SLSYLPPVKPSAIAVGTAFNHLASLAILGPVFGDTYRQAQAANSKEEFFKSK 229 SLSYLPPVKPSAIA+GT FNH ASLA+LGPVFGDTYR+A ANS EEFFKSK Sbjct: 2 SLSYLPPVKPSAIALGTLFNHAASLAVLGPVFGDTYRRAMQANSNEEFFKSK 53 >gb|EMD96540.1| hypothetical protein COCHEDRAFT_1199471 [Bipolaris maydis C5] gi|477583534|gb|ENI00632.1| hypothetical protein COCC4DRAFT_65343 [Bipolaris maydis ATCC 48331] Length = 151 Score = 92.4 bits (228), Expect = 6e-17 Identities = 43/54 (79%), Positives = 48/54 (88%) Frame = +2 Query: 68 MASLSYLPPVKPSAIAVGTAFNHLASLAILGPVFGDTYRQAQAANSKEEFFKSK 229 MASL YLPPVKPSAIA+GTAFNH SLA+LGP+FGD YR+AQ ANSKEE+F SK Sbjct: 1 MASLHYLPPVKPSAIALGTAFNHAVSLAVLGPIFGDAYRRAQQANSKEEYFHSK 54 >gb|EMD68350.1| hypothetical protein COCSADRAFT_33280 [Bipolaris sorokiniana ND90Pr] gi|576918561|gb|EUC32754.1| hypothetical protein COCCADRAFT_37358 [Bipolaris zeicola 26-R-13] gi|578493906|gb|EUN31296.1| hypothetical protein COCVIDRAFT_34244 [Bipolaris victoriae FI3] Length = 151 Score = 92.4 bits (228), Expect = 6e-17 Identities = 43/54 (79%), Positives = 48/54 (88%) Frame = +2 Query: 68 MASLSYLPPVKPSAIAVGTAFNHLASLAILGPVFGDTYRQAQAANSKEEFFKSK 229 MASL YLPPVKPSAIA+GTAFNH SLA+LGP+FGD YR+AQ ANSKEE+F SK Sbjct: 1 MASLHYLPPVKPSAIALGTAFNHAVSLAVLGPIFGDAYRRAQQANSKEEYFHSK 54 >ref|XP_007295995.1| hypothetical protein MBM_08106 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406860848|gb|EKD13905.1| hypothetical protein MBM_08106 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 150 Score = 92.0 bits (227), Expect = 8e-17 Identities = 45/52 (86%), Positives = 47/52 (90%) Frame = +2 Query: 74 SLSYLPPVKPSAIAVGTAFNHLASLAILGPVFGDTYRQAQAANSKEEFFKSK 229 SL YLPPVKPSAIA+GT FNH ASLAILGPVFGDTY +AQAANSKEEF KSK Sbjct: 2 SLHYLPPVKPSAIALGTIFNHAASLAILGPVFGDTYHRAQAANSKEEFVKSK 53 >ref|XP_003847889.1| hypothetical protein MYCGRDRAFT_106289 [Zymoseptoria tritici IPO323] gi|339467763|gb|EGP82865.1| hypothetical protein MYCGRDRAFT_106289 [Zymoseptoria tritici IPO323] Length = 150 Score = 91.7 bits (226), Expect = 1e-16 Identities = 44/52 (84%), Positives = 48/52 (92%) Frame = +2 Query: 74 SLSYLPPVKPSAIAVGTAFNHLASLAILGPVFGDTYRQAQAANSKEEFFKSK 229 SLSYLPPVKPSAIA+GT FNH ASLAILGP+FGDTYR+AQ+ANS EEF KSK Sbjct: 2 SLSYLPPVKPSAIALGTVFNHAASLAILGPLFGDTYRRAQSANSAEEFVKSK 53 >ref|XP_001934443.1| hypothetical protein PTRG_04110 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187980322|gb|EDU46948.1| hypothetical protein PTRG_04110 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 151 Score = 91.7 bits (226), Expect = 1e-16 Identities = 43/54 (79%), Positives = 48/54 (88%) Frame = +2 Query: 68 MASLSYLPPVKPSAIAVGTAFNHLASLAILGPVFGDTYRQAQAANSKEEFFKSK 229 MASL YLPPVKPSAIA+GTAFNH SLA+LGPVFGD YR+A+ ANSKEE+F SK Sbjct: 1 MASLHYLPPVKPSAIALGTAFNHAVSLAVLGPVFGDAYRRAEQANSKEEYFHSK 54 >ref|XP_001588152.1| hypothetical protein SS1G_10598 [Sclerotinia sclerotiorum 1980] gi|154694986|gb|EDN94724.1| hypothetical protein SS1G_10598 [Sclerotinia sclerotiorum 1980 UF-70] Length = 150 Score = 91.7 bits (226), Expect = 1e-16 Identities = 44/52 (84%), Positives = 47/52 (90%) Frame = +2 Query: 74 SLSYLPPVKPSAIAVGTAFNHLASLAILGPVFGDTYRQAQAANSKEEFFKSK 229 SL YLPPVKPSAIA+GT FNH ASLA+LGPVFGDTY +AQAANSKEEF KSK Sbjct: 2 SLHYLPPVKPSAIALGTIFNHAASLAVLGPVFGDTYHRAQAANSKEEFVKSK 53 >gb|EON68842.1| hypothetical protein W97_08100 [Coniosporium apollinis CBS 100218] Length = 173 Score = 91.3 bits (225), Expect = 1e-16 Identities = 44/56 (78%), Positives = 49/56 (87%) Frame = +2 Query: 62 ITMASLSYLPPVKPSAIAVGTAFNHLASLAILGPVFGDTYRQAQAANSKEEFFKSK 229 +T + + LPPVKPSAIA+GT FNH SLA+LGPVFGDTYRQAQAANSKEEFFKSK Sbjct: 21 LTSSLSADLPPVKPSAIALGTLFNHAVSLAVLGPVFGDTYRQAQAANSKEEFFKSK 76 >gb|EME84222.1| hypothetical protein MYCFIDRAFT_163055 [Pseudocercospora fijiensis CIRAD86] Length = 156 Score = 91.3 bits (225), Expect = 1e-16 Identities = 42/52 (80%), Positives = 49/52 (94%) Frame = +2 Query: 74 SLSYLPPVKPSAIAVGTAFNHLASLAILGPVFGDTYRQAQAANSKEEFFKSK 229 +L YLPPVKPSAIA+GT FNH+ASLA+LGP+FG+TYR+AQAANS EEFFKSK Sbjct: 4 TLHYLPPVKPSAIALGTVFNHVASLAVLGPLFGETYRRAQAANSAEEFFKSK 55 >gb|EEH22507.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb03] Length = 151 Score = 91.3 bits (225), Expect = 1e-16 Identities = 43/54 (79%), Positives = 47/54 (87%) Frame = +2 Query: 68 MASLSYLPPVKPSAIAVGTAFNHLASLAILGPVFGDTYRQAQAANSKEEFFKSK 229 MA L Y PPVKPSAIA+GT FNH+ASL +L PVFGDTY +AQAANSKEEFFKSK Sbjct: 1 MAILHYFPPVKPSAIALGTVFNHVASLGVLAPVFGDTYHRAQAANSKEEFFKSK 54 >ref|XP_001557524.1| hypothetical protein BC1G_04134 [Botryotinia fuckeliana B05.10] gi|347835267|emb|CCD49839.1| hypothetical protein BofuT4_P095470.1 [Botryotinia fuckeliana T4] gi|472245455|gb|EMR90027.1| putative upf0591 membrane protein [Botryotinia fuckeliana BcDW1] Length = 150 Score = 91.3 bits (225), Expect = 1e-16 Identities = 44/52 (84%), Positives = 47/52 (90%) Frame = +2 Query: 74 SLSYLPPVKPSAIAVGTAFNHLASLAILGPVFGDTYRQAQAANSKEEFFKSK 229 SL YLPPVKPSAIA+GT FNH ASLAILGPVFG+TY +AQAANSKEEF KSK Sbjct: 2 SLHYLPPVKPSAIALGTVFNHAASLAILGPVFGETYHRAQAANSKEEFIKSK 53