BLASTX nr result
ID: Akebia23_contig00033373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00033373 (708 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283419.2| PREDICTED: MATE efflux family protein 1 [Vit... 101 3e-19 ref|XP_006493918.1| PREDICTED: putative pentatricopeptide repeat... 100 8e-19 ref|XP_006421438.1| hypothetical protein CICLE_v10005013mg [Citr... 100 8e-19 ref|XP_004493520.1| PREDICTED: putative pentatricopeptide repeat... 99 1e-18 ref|XP_003553418.1| PREDICTED: putative pentatricopeptide repeat... 99 1e-18 ref|XP_003625160.1| Pentatricopeptide repeat-containing protein ... 99 1e-18 ref|XP_007162241.1| hypothetical protein PHAVU_001G135800g [Phas... 99 2e-18 ref|XP_004301443.1| PREDICTED: putative pentatricopeptide repeat... 98 2e-18 ref|XP_007204553.1| hypothetical protein PRUPE_ppa016618mg, part... 98 2e-18 ref|XP_007028824.1| Mitochondrial RNAediting factor 1 [Theobroma... 98 3e-18 ref|XP_006280222.1| hypothetical protein CARUB_v10026131mg [Caps... 98 3e-18 ref|NP_200075.1| pentatricopeptide repeat protein MEF1 [Arabidop... 97 4e-18 ref|XP_002864185.1| pentatricopeptide repeat-containing protein ... 97 5e-18 gb|EYU18757.1| hypothetical protein MIMGU_mgv1a021536mg, partial... 97 7e-18 ref|XP_004165491.1| PREDICTED: LOW QUALITY PROTEIN: putative pen... 97 7e-18 ref|XP_004136748.1| PREDICTED: putative pentatricopeptide repeat... 97 7e-18 ref|XP_006349560.1| PREDICTED: putative pentatricopeptide repeat... 96 1e-17 gb|EXB53136.1| hypothetical protein L484_006956 [Morus notabilis] 96 2e-17 ref|XP_004234835.1| PREDICTED: putative pentatricopeptide repeat... 96 2e-17 ref|XP_002322703.2| hypothetical protein POPTR_0016s05390g [Popu... 92 2e-16 >ref|XP_002283419.2| PREDICTED: MATE efflux family protein 1 [Vitis vinifera] Length = 977 Score = 101 bits (251), Expect = 3e-19 Identities = 44/49 (89%), Positives = 44/49 (89%) Frame = +1 Query: 1 RVMKNLRVCGDCHTAIKFMSKCTSRTIIVRDNNRFHRFEGGTCSCDDYW 147 RVMKNLRVCGDCHTAIKFMSKC RTIIVRDNNRFHRFE G CSC DYW Sbjct: 423 RVMKNLRVCGDCHTAIKFMSKCCGRTIIVRDNNRFHRFEDGNCSCRDYW 471 >ref|XP_006493918.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630-like [Citrus sinensis] Length = 610 Score = 99.8 bits (247), Expect = 8e-19 Identities = 42/49 (85%), Positives = 44/49 (89%) Frame = +1 Query: 1 RVMKNLRVCGDCHTAIKFMSKCTSRTIIVRDNNRFHRFEGGTCSCDDYW 147 R+MKNLRVCGDCHTAIKFMSKC+ R IIVRDNNRFHRFE G CSC DYW Sbjct: 562 RIMKNLRVCGDCHTAIKFMSKCSGRVIIVRDNNRFHRFEDGKCSCGDYW 610 >ref|XP_006421438.1| hypothetical protein CICLE_v10005013mg [Citrus clementina] gi|557523311|gb|ESR34678.1| hypothetical protein CICLE_v10005013mg [Citrus clementina] Length = 429 Score = 99.8 bits (247), Expect = 8e-19 Identities = 42/49 (85%), Positives = 44/49 (89%) Frame = +1 Query: 1 RVMKNLRVCGDCHTAIKFMSKCTSRTIIVRDNNRFHRFEGGTCSCDDYW 147 R+MKNLRVCGDCHTAIKFMSKC+ R IIVRDNNRFHRFE G CSC DYW Sbjct: 381 RIMKNLRVCGDCHTAIKFMSKCSGRVIIVRDNNRFHRFEDGKCSCGDYW 429 >ref|XP_004493520.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630-like [Cicer arietinum] Length = 594 Score = 99.0 bits (245), Expect = 1e-18 Identities = 42/49 (85%), Positives = 44/49 (89%) Frame = +1 Query: 1 RVMKNLRVCGDCHTAIKFMSKCTSRTIIVRDNNRFHRFEGGTCSCDDYW 147 RVMKNLRVCGDCHTAIKF+SKCT R IIVRDNNRFHRFE G C+C DYW Sbjct: 546 RVMKNLRVCGDCHTAIKFISKCTGRVIIVRDNNRFHRFEDGKCTCGDYW 594 >ref|XP_003553418.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630-like [Glycine max] Length = 582 Score = 99.0 bits (245), Expect = 1e-18 Identities = 42/49 (85%), Positives = 44/49 (89%) Frame = +1 Query: 1 RVMKNLRVCGDCHTAIKFMSKCTSRTIIVRDNNRFHRFEGGTCSCDDYW 147 RVMKNLRVCGDCHTAIKF+SKCT R IIVRDNNRFHRFE G C+C DYW Sbjct: 534 RVMKNLRVCGDCHTAIKFISKCTGRVIIVRDNNRFHRFEDGKCTCGDYW 582 >ref|XP_003625160.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|124360204|gb|ABN08217.1| Tetratricopeptide-like helical [Medicago truncatula] gi|355500175|gb|AES81378.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 596 Score = 99.0 bits (245), Expect = 1e-18 Identities = 42/49 (85%), Positives = 44/49 (89%) Frame = +1 Query: 1 RVMKNLRVCGDCHTAIKFMSKCTSRTIIVRDNNRFHRFEGGTCSCDDYW 147 RVMKNLRVCGDCHTAIKF+SKCT R IIVRDNNRFHRFE G C+C DYW Sbjct: 548 RVMKNLRVCGDCHTAIKFISKCTGRVIIVRDNNRFHRFEDGKCTCGDYW 596 >ref|XP_007162241.1| hypothetical protein PHAVU_001G135800g [Phaseolus vulgaris] gi|561035705|gb|ESW34235.1| hypothetical protein PHAVU_001G135800g [Phaseolus vulgaris] Length = 583 Score = 98.6 bits (244), Expect = 2e-18 Identities = 42/49 (85%), Positives = 44/49 (89%) Frame = +1 Query: 1 RVMKNLRVCGDCHTAIKFMSKCTSRTIIVRDNNRFHRFEGGTCSCDDYW 147 RVMKNLRVCGDCHTAIKF+SKCT R IIVRDNNRFHRFE G C+C DYW Sbjct: 535 RVMKNLRVCGDCHTAIKFISKCTGRVIIVRDNNRFHRFEEGKCTCGDYW 583 >ref|XP_004301443.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630-like [Fragaria vesca subsp. vesca] Length = 590 Score = 98.2 bits (243), Expect = 2e-18 Identities = 40/49 (81%), Positives = 44/49 (89%) Frame = +1 Query: 1 RVMKNLRVCGDCHTAIKFMSKCTSRTIIVRDNNRFHRFEGGTCSCDDYW 147 R+MKNLR+CGDCHTAIKFMSKC+ R IIVRDNNRFHRFE G C+C DYW Sbjct: 542 RIMKNLRICGDCHTAIKFMSKCSGRVIIVRDNNRFHRFEDGKCTCGDYW 590 >ref|XP_007204553.1| hypothetical protein PRUPE_ppa016618mg, partial [Prunus persica] gi|462400084|gb|EMJ05752.1| hypothetical protein PRUPE_ppa016618mg, partial [Prunus persica] Length = 524 Score = 98.2 bits (243), Expect = 2e-18 Identities = 40/49 (81%), Positives = 44/49 (89%) Frame = +1 Query: 1 RVMKNLRVCGDCHTAIKFMSKCTSRTIIVRDNNRFHRFEGGTCSCDDYW 147 R+MKNLR+CGDCHTAIKFMSKC+ R IIVRDNNRFHRFE G C+C DYW Sbjct: 476 RIMKNLRICGDCHTAIKFMSKCSGRVIIVRDNNRFHRFEDGKCTCGDYW 524 >ref|XP_007028824.1| Mitochondrial RNAediting factor 1 [Theobroma cacao] gi|508717429|gb|EOY09326.1| Mitochondrial RNAediting factor 1 [Theobroma cacao] Length = 595 Score = 97.8 bits (242), Expect = 3e-18 Identities = 41/49 (83%), Positives = 43/49 (87%) Frame = +1 Query: 1 RVMKNLRVCGDCHTAIKFMSKCTSRTIIVRDNNRFHRFEGGTCSCDDYW 147 RVMKNLR+CGDCHTAIKFMSKC+ R IIVRDNNRFH FE G CSC DYW Sbjct: 547 RVMKNLRICGDCHTAIKFMSKCSGRVIIVRDNNRFHHFEDGKCSCGDYW 595 >ref|XP_006280222.1| hypothetical protein CARUB_v10026131mg [Capsella rubella] gi|482548926|gb|EOA13120.1| hypothetical protein CARUB_v10026131mg [Capsella rubella] Length = 588 Score = 97.8 bits (242), Expect = 3e-18 Identities = 42/49 (85%), Positives = 43/49 (87%) Frame = +1 Query: 1 RVMKNLRVCGDCHTAIKFMSKCTSRTIIVRDNNRFHRFEGGTCSCDDYW 147 RVMKNLRVCGDCH AIKFMS CT R IIVRDNNRFHRFE G CSC+DYW Sbjct: 540 RVMKNLRVCGDCHNAIKFMSICTGRVIIVRDNNRFHRFENGKCSCNDYW 588 >ref|NP_200075.1| pentatricopeptide repeat protein MEF1 [Arabidopsis thaliana] gi|75180446|sp|Q9LTF4.1|PP429_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At5g52630 gi|8953718|dbj|BAA98081.1| selenium-binding protein-like [Arabidopsis thaliana] gi|332008860|gb|AED96243.1| pentatricopeptide repeat protein MEF1 [Arabidopsis thaliana] Length = 588 Score = 97.4 bits (241), Expect = 4e-18 Identities = 42/49 (85%), Positives = 43/49 (87%) Frame = +1 Query: 1 RVMKNLRVCGDCHTAIKFMSKCTSRTIIVRDNNRFHRFEGGTCSCDDYW 147 RVMKNLRVCGDCH AIKFMS CT R IIVRDNNRFHRFE G CSC+DYW Sbjct: 540 RVMKNLRVCGDCHNAIKFMSVCTRRVIIVRDNNRFHRFEDGKCSCNDYW 588 >ref|XP_002864185.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297310020|gb|EFH40444.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 588 Score = 97.1 bits (240), Expect = 5e-18 Identities = 42/49 (85%), Positives = 43/49 (87%) Frame = +1 Query: 1 RVMKNLRVCGDCHTAIKFMSKCTSRTIIVRDNNRFHRFEGGTCSCDDYW 147 RVMKNLRVCGDCH AIKFMS CT R IIVRDNNRFHRFE G CSC+DYW Sbjct: 540 RVMKNLRVCGDCHNAIKFMSICTRRVIIVRDNNRFHRFEDGKCSCNDYW 588 >gb|EYU18757.1| hypothetical protein MIMGU_mgv1a021536mg, partial [Mimulus guttatus] Length = 589 Score = 96.7 bits (239), Expect = 7e-18 Identities = 41/49 (83%), Positives = 42/49 (85%) Frame = +1 Query: 1 RVMKNLRVCGDCHTAIKFMSKCTSRTIIVRDNNRFHRFEGGTCSCDDYW 147 RVMKNLRVCGDCH AIKF+SKC R IIVRDNNRFHRFE G CSC DYW Sbjct: 541 RVMKNLRVCGDCHVAIKFISKCVGRVIIVRDNNRFHRFENGECSCGDYW 589 >ref|XP_004165491.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At5g52630-like [Cucumis sativus] Length = 598 Score = 96.7 bits (239), Expect = 7e-18 Identities = 41/49 (83%), Positives = 42/49 (85%) Frame = +1 Query: 1 RVMKNLRVCGDCHTAIKFMSKCTSRTIIVRDNNRFHRFEGGTCSCDDYW 147 RVMKNLRVCGDCH AIKFMSKC R +IVRDNNRFHRFE G CSC DYW Sbjct: 550 RVMKNLRVCGDCHAAIKFMSKCCGRVLIVRDNNRFHRFEDGKCSCGDYW 598 >ref|XP_004136748.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630-like [Cucumis sativus] Length = 598 Score = 96.7 bits (239), Expect = 7e-18 Identities = 41/49 (83%), Positives = 42/49 (85%) Frame = +1 Query: 1 RVMKNLRVCGDCHTAIKFMSKCTSRTIIVRDNNRFHRFEGGTCSCDDYW 147 RVMKNLRVCGDCH AIKFMSKC R +IVRDNNRFHRFE G CSC DYW Sbjct: 550 RVMKNLRVCGDCHAAIKFMSKCCGRVLIVRDNNRFHRFEDGKCSCGDYW 598 >ref|XP_006349560.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630-like [Solanum tuberosum] Length = 596 Score = 95.9 bits (237), Expect = 1e-17 Identities = 41/49 (83%), Positives = 42/49 (85%) Frame = +1 Query: 1 RVMKNLRVCGDCHTAIKFMSKCTSRTIIVRDNNRFHRFEGGTCSCDDYW 147 RVMKNLRVCGDCH AIK +SKCT R IIVRDNNRFHRFE G CSC DYW Sbjct: 548 RVMKNLRVCGDCHNAIKIISKCTKRVIIVRDNNRFHRFEDGKCSCGDYW 596 >gb|EXB53136.1| hypothetical protein L484_006956 [Morus notabilis] Length = 616 Score = 95.5 bits (236), Expect = 2e-17 Identities = 40/49 (81%), Positives = 43/49 (87%) Frame = +1 Query: 1 RVMKNLRVCGDCHTAIKFMSKCTSRTIIVRDNNRFHRFEGGTCSCDDYW 147 R+MKNLRVCGDCHTAIKFMSKC+ R IIVRDNNRFH FE G C+C DYW Sbjct: 568 RIMKNLRVCGDCHTAIKFMSKCSGRVIIVRDNNRFHWFEDGKCTCGDYW 616 >ref|XP_004234835.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630-like [Solanum lycopersicum] Length = 596 Score = 95.5 bits (236), Expect = 2e-17 Identities = 40/49 (81%), Positives = 42/49 (85%) Frame = +1 Query: 1 RVMKNLRVCGDCHTAIKFMSKCTSRTIIVRDNNRFHRFEGGTCSCDDYW 147 R+MKNLRVCGDCH AIK +SKCT R IIVRDNNRFHRFE G CSC DYW Sbjct: 548 RIMKNLRVCGDCHNAIKIISKCTKRVIIVRDNNRFHRFEDGKCSCGDYW 596 >ref|XP_002322703.2| hypothetical protein POPTR_0016s05390g [Populus trichocarpa] gi|550320891|gb|EEF04464.2| hypothetical protein POPTR_0016s05390g [Populus trichocarpa] Length = 627 Score = 92.0 bits (227), Expect = 2e-16 Identities = 39/49 (79%), Positives = 42/49 (85%) Frame = +1 Query: 1 RVMKNLRVCGDCHTAIKFMSKCTSRTIIVRDNNRFHRFEGGTCSCDDYW 147 R+MKNLRVCGDCH AIKF+SK + R IIVRDNNRFHRFE G CSC DYW Sbjct: 579 RIMKNLRVCGDCHNAIKFISKLSGRVIIVRDNNRFHRFEDGKCSCADYW 627