BLASTX nr result
ID: Akebia23_contig00033276
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00033276 (630 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN08628.1| RNA-directed DNA polymerase (Reverse transcriptas... 50 8e-06 >gb|ABN08628.1| RNA-directed DNA polymerase (Reverse transcriptase) [Medicago truncatula] Length = 243 Score = 50.4 bits (119), Expect(2) = 8e-06 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = -2 Query: 101 SSIIPIYKNYGDVQNSNHYYGIKLMNHTTKLW 6 S++IPIYKN GD+Q+ +Y GIKLM+HT KLW Sbjct: 76 STLIPIYKNKGDIQHCANYRGIKLMSHTMKLW 107 Score = 25.4 bits (54), Expect(2) = 8e-06 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -1 Query: 204 PMEVREYMGKSGLCELTKLCNKVFK 130 P+EV + +G G+ LTKL N++ K Sbjct: 41 PIEVWKSLGDRGIVWLTKLFNEIMK 65