BLASTX nr result
ID: Akebia23_contig00033235
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00033235 (277 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG18207.1| hypothetical protein MPH_04597 [Macrophomina phas... 56 5e-06 >gb|EKG18207.1| hypothetical protein MPH_04597 [Macrophomina phaseolina MS6] Length = 177 Score = 56.2 bits (134), Expect = 5e-06 Identities = 34/84 (40%), Positives = 44/84 (52%), Gaps = 6/84 (7%) Frame = +3 Query: 24 TLRPGAPPDIEQDFVALWPGLWSPYSFSSDLVQSVISVHKRSYMQSFCGAKKGQWC--AQ 197 TL PG PD +QD + LWPG+ + + LVQS++S + Q CG K G+WC A Sbjct: 45 TLHPGKTPDPQQDRMVLWPGMGTS---NGQLVQSIVSASAEAAAQ--CGGKSGEWCVFAS 99 Query: 198 AYV----LVGGYKPTTPARGYPIN 257 AY L G KP T +G N Sbjct: 100 AYTGQTQLSGDAKPLTATQGVKNN 123