BLASTX nr result
ID: Akebia23_contig00033226
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00033226 (314 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003602214.1| Cyclic nucleotide-gated ion channel [Medicag... 59 7e-07 gb|ACJ85780.1| unknown [Medicago truncatula] 56 5e-06 ref|XP_003526699.1| PREDICTED: cyclic nucleotide-gated ion chann... 56 6e-06 >ref|XP_003602214.1| Cyclic nucleotide-gated ion channel [Medicago truncatula] gi|355491262|gb|AES72465.1| Cyclic nucleotide-gated ion channel [Medicago truncatula] Length = 770 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = -3 Query: 312 AIRRNGTRKTRLPERLPPIMLQKPTEPDFFSEDR 211 AIR+NG+RK R+PERLPP+MLQKPTEPDF +E++ Sbjct: 737 AIRKNGSRKPRVPERLPPMMLQKPTEPDFTAEEQ 770 >gb|ACJ85780.1| unknown [Medicago truncatula] Length = 234 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = -3 Query: 312 AIRRNGTRKTRLPERLPPIMLQKPTEPDFFSEDR 211 AIR+N +RK R+PERLPP+MLQKPTEPDF +E++ Sbjct: 201 AIRKNDSRKPRVPERLPPMMLQKPTEPDFTAEEQ 234 >ref|XP_003526699.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform X1 [Glycine max] gi|571460213|ref|XP_006581633.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform X2 [Glycine max] Length = 715 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = -3 Query: 309 IRRNGTRKTRLPERLPPIMLQKPTEPDFFSEDR 211 +RRNGTRKTR+PER+ P++LQKP EPDF SE++ Sbjct: 683 LRRNGTRKTRVPERISPMLLQKPAEPDFTSEEQ 715