BLASTX nr result
ID: Akebia23_contig00033202
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00033202 (416 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006844845.1| hypothetical protein AMTR_s00058p00088010 [A... 59 5e-07 >ref|XP_006844845.1| hypothetical protein AMTR_s00058p00088010 [Amborella trichopoda] gi|548847336|gb|ERN06520.1| hypothetical protein AMTR_s00058p00088010 [Amborella trichopoda] Length = 697 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = -1 Query: 170 MGCIASKQAVSVTPALDYSGAFRDNESGILNSSRRNRAG 54 MGCIASKQAVSVTPALDYSG FR+ SGI S R+RAG Sbjct: 1 MGCIASKQAVSVTPALDYSGGFRNQNSGIHVISLRSRAG 39