BLASTX nr result
ID: Akebia23_contig00033191
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00033191 (611 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001268880.1| C2H2 transcription factor (Rpn4), putative [... 65 2e-08 gb|ELR05820.1| hypothetical protein GMDG_01897 [Pseudogymnoascus... 64 3e-08 gb|EMF14542.1| hypothetical protein SEPMUDRAFT_62999 [Sphaerulin... 64 4e-08 gb|EME83251.1| hypothetical protein MYCFIDRAFT_211282 [Pseudocer... 64 4e-08 gb|EUN24561.1| hypothetical protein COCVIDRAFT_28755 [Bipolaris ... 63 6e-08 gb|EUC46851.1| hypothetical protein COCMIDRAFT_25193 [Bipolaris ... 63 6e-08 gb|EUC31471.1| hypothetical protein COCCADRAFT_6612 [Bipolaris z... 63 6e-08 ref|XP_007588980.1| putative c2h2 transcription factor protein [... 63 6e-08 gb|EOA81154.1| hypothetical protein SETTUDRAFT_100153 [Setosphae... 63 6e-08 gb|EME46088.1| hypothetical protein DOTSEDRAFT_70172 [Dothistrom... 63 6e-08 gb|EMD97724.1| hypothetical protein COCHEDRAFT_1084731 [Bipolari... 63 6e-08 gb|EMD60069.1| hypothetical protein COCSADRAFT_248227 [Bipolaris... 63 6e-08 gb|EKG21573.1| Zinc finger C2H2-type protein [Macrophomina phase... 63 6e-08 ref|XP_003835179.1| hypothetical protein LEMA_P045200.1 [Leptosp... 63 6e-08 ref|XP_003299720.1| hypothetical protein PTT_10773 [Pyrenophora ... 63 6e-08 ref|XP_001934759.1| hypothetical protein PTRG_04426 [Pyrenophora... 63 6e-08 ref|XP_001795835.1| hypothetical protein SNOG_05430 [Phaeosphaer... 63 6e-08 gb|EON62817.1| hypothetical protein W97_02042 [Coniosporium apol... 63 8e-08 gb|EYE92331.1| hypothetical protein EURHEDRAFT_462630 [Aspergill... 62 1e-07 ref|XP_752745.1| C2H2 transcription factor (Rpn4) [Aspergillus f... 62 1e-07 >ref|XP_001268880.1| C2H2 transcription factor (Rpn4), putative [Aspergillus clavatus NRRL 1] gi|119397023|gb|EAW07454.1| C2H2 transcription factor (Rpn4), putative [Aspergillus clavatus NRRL 1] Length = 747 Score = 64.7 bits (156), Expect = 2e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 606 CREEKTFSRNDALTRHMRVVHPEVDFQGKRSRR 508 CREEKTFSRNDALTRHMRVVHPEVD+ GK+ RR Sbjct: 712 CREEKTFSRNDALTRHMRVVHPEVDWPGKQRRR 744 >gb|ELR05820.1| hypothetical protein GMDG_01897 [Pseudogymnoascus destructans 20631-21] Length = 744 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 609 YCREEKTFSRNDALTRHMRVVHPEVDFQGKRSRR 508 +C EEKTFSRNDALTRHMRVVHPE+DF GK RR Sbjct: 710 FCTEEKTFSRNDALTRHMRVVHPEIDFPGKTRRR 743 >gb|EMF14542.1| hypothetical protein SEPMUDRAFT_62999 [Sphaerulina musiva SO2202] Length = 716 Score = 63.5 bits (153), Expect = 4e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 606 CREEKTFSRNDALTRHMRVVHPEVDFQGKRSRR 508 CREEKTFSRNDALTRHMRVVHPEV+ GKRS+R Sbjct: 682 CREEKTFSRNDALTRHMRVVHPEVESFGKRSKR 714 >gb|EME83251.1| hypothetical protein MYCFIDRAFT_211282 [Pseudocercospora fijiensis CIRAD86] Length = 281 Score = 63.5 bits (153), Expect = 4e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 606 CREEKTFSRNDALTRHMRVVHPEVDFQGKRSRR 508 CREEKTFSRNDALTRHMRVVHPEV+ GKRS+R Sbjct: 247 CREEKTFSRNDALTRHMRVVHPEVEAFGKRSKR 279 >gb|EUN24561.1| hypothetical protein COCVIDRAFT_28755 [Bipolaris victoriae FI3] Length = 697 Score = 63.2 bits (152), Expect = 6e-08 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -3 Query: 606 CREEKTFSRNDALTRHMRVVHPEVDFQGKRSRR 508 C EEKTFSRNDALTRHMRVVHPEVDF GK RR Sbjct: 660 CVEEKTFSRNDALTRHMRVVHPEVDFPGKHRRR 692 >gb|EUC46851.1| hypothetical protein COCMIDRAFT_25193 [Bipolaris oryzae ATCC 44560] Length = 717 Score = 63.2 bits (152), Expect = 6e-08 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -3 Query: 606 CREEKTFSRNDALTRHMRVVHPEVDFQGKRSRR 508 C EEKTFSRNDALTRHMRVVHPEVDF GK RR Sbjct: 680 CVEEKTFSRNDALTRHMRVVHPEVDFPGKHRRR 712 >gb|EUC31471.1| hypothetical protein COCCADRAFT_6612 [Bipolaris zeicola 26-R-13] Length = 697 Score = 63.2 bits (152), Expect = 6e-08 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -3 Query: 606 CREEKTFSRNDALTRHMRVVHPEVDFQGKRSRR 508 C EEKTFSRNDALTRHMRVVHPEVDF GK RR Sbjct: 660 CVEEKTFSRNDALTRHMRVVHPEVDFPGKHRRR 692 >ref|XP_007588980.1| putative c2h2 transcription factor protein [Neofusicoccum parvum UCRNP2] gi|485916150|gb|EOD43549.1| putative c2h2 transcription factor protein [Neofusicoccum parvum UCRNP2] Length = 622 Score = 63.2 bits (152), Expect = 6e-08 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -3 Query: 606 CREEKTFSRNDALTRHMRVVHPEVDFQGKRSRR 508 C EEKTFSRNDALTRHMRVVHPEVDF GK RR Sbjct: 583 CVEEKTFSRNDALTRHMRVVHPEVDFPGKHRRR 615 >gb|EOA81154.1| hypothetical protein SETTUDRAFT_100153 [Setosphaeria turcica Et28A] Length = 695 Score = 63.2 bits (152), Expect = 6e-08 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -3 Query: 606 CREEKTFSRNDALTRHMRVVHPEVDFQGKRSRR 508 C EEKTFSRNDALTRHMRVVHPEVDF GK RR Sbjct: 658 CVEEKTFSRNDALTRHMRVVHPEVDFPGKHRRR 690 >gb|EME46088.1| hypothetical protein DOTSEDRAFT_70172 [Dothistroma septosporum NZE10] Length = 709 Score = 63.2 bits (152), Expect = 6e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -3 Query: 606 CREEKTFSRNDALTRHMRVVHPEVDFQGKRSRR 508 CREEKTFSRNDALTRHMRVVHPEV+ GKR RR Sbjct: 675 CREEKTFSRNDALTRHMRVVHPEVESFGKRGRR 707 >gb|EMD97724.1| hypothetical protein COCHEDRAFT_1084731 [Bipolaris maydis C5] gi|477585793|gb|ENI02880.1| hypothetical protein COCC4DRAFT_144316 [Bipolaris maydis ATCC 48331] Length = 675 Score = 63.2 bits (152), Expect = 6e-08 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -3 Query: 606 CREEKTFSRNDALTRHMRVVHPEVDFQGKRSRR 508 C EEKTFSRNDALTRHMRVVHPEVDF GK RR Sbjct: 638 CVEEKTFSRNDALTRHMRVVHPEVDFPGKHRRR 670 >gb|EMD60069.1| hypothetical protein COCSADRAFT_248227 [Bipolaris sorokiniana ND90Pr] Length = 675 Score = 63.2 bits (152), Expect = 6e-08 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -3 Query: 606 CREEKTFSRNDALTRHMRVVHPEVDFQGKRSRR 508 C EEKTFSRNDALTRHMRVVHPEVDF GK RR Sbjct: 638 CVEEKTFSRNDALTRHMRVVHPEVDFPGKHRRR 670 >gb|EKG21573.1| Zinc finger C2H2-type protein [Macrophomina phaseolina MS6] Length = 745 Score = 63.2 bits (152), Expect = 6e-08 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -3 Query: 606 CREEKTFSRNDALTRHMRVVHPEVDFQGKRSRR 508 C EEKTFSRNDALTRHMRVVHPEVDF GK RR Sbjct: 706 CVEEKTFSRNDALTRHMRVVHPEVDFPGKHRRR 738 >ref|XP_003835179.1| hypothetical protein LEMA_P045200.1 [Leptosphaeria maculans JN3] gi|312211730|emb|CBX91814.1| hypothetical protein LEMA_P045200.1 [Leptosphaeria maculans JN3] Length = 713 Score = 63.2 bits (152), Expect = 6e-08 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -3 Query: 606 CREEKTFSRNDALTRHMRVVHPEVDFQGKRSRR 508 C EEKTFSRNDALTRHMRVVHPEVDF GK RR Sbjct: 676 CVEEKTFSRNDALTRHMRVVHPEVDFPGKHRRR 708 >ref|XP_003299720.1| hypothetical protein PTT_10773 [Pyrenophora teres f. teres 0-1] gi|311326501|gb|EFQ92191.1| hypothetical protein PTT_10773 [Pyrenophora teres f. teres 0-1] Length = 701 Score = 63.2 bits (152), Expect = 6e-08 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -3 Query: 606 CREEKTFSRNDALTRHMRVVHPEVDFQGKRSRR 508 C EEKTFSRNDALTRHMRVVHPEVDF GK RR Sbjct: 664 CVEEKTFSRNDALTRHMRVVHPEVDFPGKHRRR 696 >ref|XP_001934759.1| hypothetical protein PTRG_04426 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187980638|gb|EDU47264.1| hypothetical protein PTRG_04426 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 698 Score = 63.2 bits (152), Expect = 6e-08 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -3 Query: 606 CREEKTFSRNDALTRHMRVVHPEVDFQGKRSRR 508 C EEKTFSRNDALTRHMRVVHPEVDF GK RR Sbjct: 661 CVEEKTFSRNDALTRHMRVVHPEVDFPGKHRRR 693 >ref|XP_001795835.1| hypothetical protein SNOG_05430 [Phaeosphaeria nodorum SN15] gi|111066701|gb|EAT87821.1| hypothetical protein SNOG_05430 [Phaeosphaeria nodorum SN15] Length = 715 Score = 63.2 bits (152), Expect = 6e-08 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -3 Query: 606 CREEKTFSRNDALTRHMRVVHPEVDFQGKRSRR 508 C EEKTFSRNDALTRHMRVVHPEVDF GK RR Sbjct: 678 CVEEKTFSRNDALTRHMRVVHPEVDFPGKHRRR 710 >gb|EON62817.1| hypothetical protein W97_02042 [Coniosporium apollinis CBS 100218] Length = 724 Score = 62.8 bits (151), Expect = 8e-08 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -3 Query: 606 CREEKTFSRNDALTRHMRVVHPEVDFQGKRSRR 508 C EEKTFSRNDALTRHMRVVHPE+DF GK RR Sbjct: 687 CVEEKTFSRNDALTRHMRVVHPEIDFPGKNRRR 719 >gb|EYE92331.1| hypothetical protein EURHEDRAFT_462630 [Aspergillus ruber CBS 135680] Length = 726 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 606 CREEKTFSRNDALTRHMRVVHPEVDFQGKRSRR 508 C EEKTFSRNDALTRHMRVVHPEVD+ GK+ RR Sbjct: 691 CTEEKTFSRNDALTRHMRVVHPEVDWPGKQRRR 723 >ref|XP_752745.1| C2H2 transcription factor (Rpn4) [Aspergillus fumigatus Af293] gi|66850380|gb|EAL90707.1| C2H2 transcription factor (Rpn4), putative [Aspergillus fumigatus Af293] gi|159131500|gb|EDP56613.1| C2H2 transcription factor (Rpn4), putative [Aspergillus fumigatus A1163] Length = 729 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 606 CREEKTFSRNDALTRHMRVVHPEVDFQGKRSRR 508 C EEKTFSRNDALTRHMRVVHPEVD+ GK+ RR Sbjct: 694 CTEEKTFSRNDALTRHMRVVHPEVDWPGKQRRR 726