BLASTX nr result
ID: Akebia23_contig00033160
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00033160 (686 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006653654.1| PREDICTED: probable plastid-lipid-associated... 67 5e-09 ref|XP_006838194.1| hypothetical protein AMTR_s00106p00140380 [A... 66 9e-09 gb|EXB37578.1| putative plastid-lipid-associated protein 11 [Mor... 66 1e-08 ref|XP_007218417.1| hypothetical protein PRUPE_ppa011530mg [Prun... 66 1e-08 ref|XP_002511641.1| structural molecule, putative [Ricinus commu... 65 2e-08 ref|XP_006375261.1| hypothetical protein POPTR_0014s05740g [Popu... 64 4e-08 ref|NP_191914.1| putative plastid-lipid-associated protein 11 [A... 64 5e-08 ref|XP_001784533.1| predicted protein [Physcomitrella patens] gi... 64 5e-08 gb|EMT21025.1| Putative plastid-lipid-associated protein 11, chl... 63 8e-08 gb|EMS54551.1| putative plastid-lipid-associated protein 11, chl... 63 8e-08 ref|XP_003580284.1| PREDICTED: probable plastid-lipid-associated... 63 8e-08 dbj|BAK05444.1| predicted protein [Hordeum vulgare subsp. vulgare] 63 8e-08 ref|XP_002875050.1| plastid-lipid associated protein pap [Arabid... 63 8e-08 ref|XP_006490841.1| PREDICTED: probable plastid-lipid-associated... 63 1e-07 ref|XP_006445339.1| hypothetical protein CICLE_v10022767mg [Citr... 63 1e-07 ref|XP_004140490.1| PREDICTED: probable plastid-lipid-associated... 63 1e-07 gb|EYU31935.1| hypothetical protein MIMGU_mgv1a013200mg [Mimulus... 62 2e-07 ref|XP_004976442.1| PREDICTED: probable plastid-lipid-associated... 62 2e-07 ref|XP_004514232.1| PREDICTED: probable plastid-lipid-associated... 62 2e-07 gb|EEE61457.1| hypothetical protein OsJ_15704 [Oryza sativa Japo... 62 2e-07 >ref|XP_006653654.1| PREDICTED: probable plastid-lipid-associated protein 11-like [Oryza brachyantha] Length = 226 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 686 WFECIYLDNEIRVAKDIRGDYLVVDRAPYSWKE 588 WF+ +YLDNEIRVAKDIRGDYLVV+RAPYSW E Sbjct: 194 WFDTVYLDNEIRVAKDIRGDYLVVERAPYSWNE 226 >ref|XP_006838194.1| hypothetical protein AMTR_s00106p00140380 [Amborella trichopoda] gi|548840652|gb|ERN00763.1| hypothetical protein AMTR_s00106p00140380 [Amborella trichopoda] Length = 226 Score = 66.2 bits (160), Expect = 9e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 686 WFECIYLDNEIRVAKDIRGDYLVVDRAPYSWKE 588 WFE IYLD++IRV KDIRGDYLVVDRAPY+WKE Sbjct: 194 WFESIYLDDDIRVVKDIRGDYLVVDRAPYNWKE 226 >gb|EXB37578.1| putative plastid-lipid-associated protein 11 [Morus notabilis] Length = 211 Score = 65.9 bits (159), Expect = 1e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -1 Query: 686 WFECIYLDNEIRVAKDIRGDYLVVDRAPYSWKE 588 WF+ +YLD+EIRV KDIRGDYLVVDRAPY+WKE Sbjct: 179 WFDTVYLDDEIRVVKDIRGDYLVVDRAPYAWKE 211 >ref|XP_007218417.1| hypothetical protein PRUPE_ppa011530mg [Prunus persica] gi|462414879|gb|EMJ19616.1| hypothetical protein PRUPE_ppa011530mg [Prunus persica] Length = 207 Score = 65.9 bits (159), Expect = 1e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -1 Query: 686 WFECIYLDNEIRVAKDIRGDYLVVDRAPYSWKE 588 WF+ +YLD+EIRV KDIRGDYLVVDRAPY+WKE Sbjct: 175 WFDTVYLDDEIRVVKDIRGDYLVVDRAPYAWKE 207 >ref|XP_002511641.1| structural molecule, putative [Ricinus communis] gi|223548821|gb|EEF50310.1| structural molecule, putative [Ricinus communis] Length = 217 Score = 65.1 bits (157), Expect = 2e-08 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -1 Query: 686 WFECIYLDNEIRVAKDIRGDYLVVDRAPYSWKE 588 WFE +Y+D++IRVAKDIRGDYLVVDRAPY+W+E Sbjct: 185 WFESVYVDDDIRVAKDIRGDYLVVDRAPYAWRE 217 >ref|XP_006375261.1| hypothetical protein POPTR_0014s05740g [Populus trichocarpa] gi|566202787|ref|XP_006375262.1| hypothetical protein POPTR_0014s05740g [Populus trichocarpa] gi|566202789|ref|XP_006375263.1| hypothetical protein POPTR_0014s05740g [Populus trichocarpa] gi|550323580|gb|ERP53058.1| hypothetical protein POPTR_0014s05740g [Populus trichocarpa] gi|550323581|gb|ERP53059.1| hypothetical protein POPTR_0014s05740g [Populus trichocarpa] gi|550323582|gb|ERP53060.1| hypothetical protein POPTR_0014s05740g [Populus trichocarpa] Length = 211 Score = 64.3 bits (155), Expect = 4e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 686 WFECIYLDNEIRVAKDIRGDYLVVDRAPYSWKE 588 WFE +Y+D EIRV KDIRGDYLVVD+APY+WKE Sbjct: 179 WFESLYIDEEIRVVKDIRGDYLVVDKAPYAWKE 211 >ref|NP_191914.1| putative plastid-lipid-associated protein 11 [Arabidopsis thaliana] gi|75100154|sp|O81304.1|PAP11_ARATH RecName: Full=Probable plastid-lipid-associated protein 11; AltName: Full=Fibrillin-9 gi|3193328|gb|AAC19310.1| F6N15.13 gene product [Arabidopsis thaliana] gi|7267090|emb|CAB80761.1| predicted protein of unknown function [Arabidopsis thaliana] gi|15809917|gb|AAL06886.1| AT4g00030/F6N15_13 [Arabidopsis thaliana] gi|18377823|gb|AAL67098.1| AT4g00030/F6N15_13 [Arabidopsis thaliana] gi|332656416|gb|AEE81816.1| putative plastid-lipid-associated protein 11 [Arabidopsis thaliana] Length = 212 Score = 63.9 bits (154), Expect = 5e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 686 WFECIYLDNEIRVAKDIRGDYLVVDRAPYSWKE 588 WFE +Y+D EIRVAKDIRGDYL+VDRAPY+W E Sbjct: 177 WFENVYMDGEIRVAKDIRGDYLIVDRAPYNWTE 209 >ref|XP_001784533.1| predicted protein [Physcomitrella patens] gi|162663914|gb|EDQ50654.1| predicted protein [Physcomitrella patens] Length = 218 Score = 63.9 bits (154), Expect = 5e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 686 WFECIYLDNEIRVAKDIRGDYLVVDRAPYSW 594 WFE IYLD++IRVAKDIRGDYLVVDRAPY+W Sbjct: 184 WFESIYLDDDIRVAKDIRGDYLVVDRAPYTW 214 >gb|EMT21025.1| Putative plastid-lipid-associated protein 11, chloroplastic [Aegilops tauschii] Length = 145 Score = 63.2 bits (152), Expect = 8e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 686 WFECIYLDNEIRVAKDIRGDYLVVDRAPYSW 594 WF+ +YLD+EIRVAKDIRGDYLVV+RAPYSW Sbjct: 113 WFDTVYLDDEIRVAKDIRGDYLVVERAPYSW 143 >gb|EMS54551.1| putative plastid-lipid-associated protein 11, chloroplastic [Triticum urartu] Length = 180 Score = 63.2 bits (152), Expect = 8e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 686 WFECIYLDNEIRVAKDIRGDYLVVDRAPYSW 594 WF+ +YLD+EIRVAKDIRGDYLVV+RAPYSW Sbjct: 148 WFDTVYLDDEIRVAKDIRGDYLVVERAPYSW 178 >ref|XP_003580284.1| PREDICTED: probable plastid-lipid-associated protein 11, chloroplastic-like [Brachypodium distachyon] Length = 221 Score = 63.2 bits (152), Expect = 8e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 686 WFECIYLDNEIRVAKDIRGDYLVVDRAPYSW 594 WF+ +YLD+EIRVAKDIRGDYLVV+RAPYSW Sbjct: 189 WFDTVYLDDEIRVAKDIRGDYLVVERAPYSW 219 >dbj|BAK05444.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 222 Score = 63.2 bits (152), Expect = 8e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 686 WFECIYLDNEIRVAKDIRGDYLVVDRAPYSW 594 WF+ +YLD+EIRVAKDIRGDYLVV+RAPYSW Sbjct: 190 WFDTVYLDDEIRVAKDIRGDYLVVERAPYSW 220 >ref|XP_002875050.1| plastid-lipid associated protein pap [Arabidopsis lyrata subsp. lyrata] gi|297320887|gb|EFH51309.1| plastid-lipid associated protein pap [Arabidopsis lyrata subsp. lyrata] Length = 209 Score = 63.2 bits (152), Expect = 8e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 686 WFECIYLDNEIRVAKDIRGDYLVVDRAPYSWKE 588 WFE +Y+D EIRVAKDIRGDYL+VDRAPY+W E Sbjct: 177 WFENVYMDAEIRVAKDIRGDYLIVDRAPYNWTE 209 >ref|XP_006490841.1| PREDICTED: probable plastid-lipid-associated protein 11-like isoform X1 [Citrus sinensis] Length = 222 Score = 62.8 bits (151), Expect = 1e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 686 WFECIYLDNEIRVAKDIRGDYLVVDRAPYSWKE 588 WFE +YLD+EIRV KDIRGDYLVV+RAPY W E Sbjct: 190 WFETVYLDDEIRVVKDIRGDYLVVERAPYQWTE 222 >ref|XP_006445339.1| hypothetical protein CICLE_v10022767mg [Citrus clementina] gi|567905704|ref|XP_006445340.1| hypothetical protein CICLE_v10022767mg [Citrus clementina] gi|567905706|ref|XP_006445341.1| hypothetical protein CICLE_v10022767mg [Citrus clementina] gi|567905708|ref|XP_006445342.1| hypothetical protein CICLE_v10022767mg [Citrus clementina] gi|557547601|gb|ESR58579.1| hypothetical protein CICLE_v10022767mg [Citrus clementina] gi|557547602|gb|ESR58580.1| hypothetical protein CICLE_v10022767mg [Citrus clementina] gi|557547603|gb|ESR58581.1| hypothetical protein CICLE_v10022767mg [Citrus clementina] gi|557547604|gb|ESR58582.1| hypothetical protein CICLE_v10022767mg [Citrus clementina] Length = 140 Score = 62.8 bits (151), Expect = 1e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 686 WFECIYLDNEIRVAKDIRGDYLVVDRAPYSWKE 588 WFE +YLD+EIRV KDIRGDYLVV+RAPY W E Sbjct: 108 WFETVYLDDEIRVVKDIRGDYLVVERAPYQWTE 140 >ref|XP_004140490.1| PREDICTED: probable plastid-lipid-associated protein 11, chloroplastic-like [Cucumis sativus] Length = 213 Score = 62.8 bits (151), Expect = 1e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 686 WFECIYLDNEIRVAKDIRGDYLVVDRAPYSWKE 588 WF+ +YLD+EIRV KDIRGDYL+V+RAPYSW E Sbjct: 181 WFDTVYLDDEIRVVKDIRGDYLIVERAPYSWTE 213 >gb|EYU31935.1| hypothetical protein MIMGU_mgv1a013200mg [Mimulus guttatus] Length = 228 Score = 62.0 bits (149), Expect = 2e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 686 WFECIYLDNEIRVAKDIRGDYLVVDRAPYSWKE 588 WFE +Y+D+EIRV KDIR DYL+V+RAPYSWKE Sbjct: 196 WFESLYIDDEIRVVKDIRQDYLIVERAPYSWKE 228 >ref|XP_004976442.1| PREDICTED: probable plastid-lipid-associated protein 11, chloroplastic-like [Setaria italica] Length = 221 Score = 62.0 bits (149), Expect = 2e-07 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -1 Query: 686 WFECIYLDNEIRVAKDIRGDYLVVDRAPYSW 594 WF+ +YLD++IRVAKDIRGDYLVV+RAPYSW Sbjct: 189 WFDTVYLDDDIRVAKDIRGDYLVVERAPYSW 219 >ref|XP_004514232.1| PREDICTED: probable plastid-lipid-associated protein 11, chloroplastic-like [Cicer arietinum] Length = 214 Score = 62.0 bits (149), Expect = 2e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 686 WFECIYLDNEIRVAKDIRGDYLVVDRAPYSWKE 588 WF+ +YLD+++RV KDIRGDYLVVDRA YSWKE Sbjct: 182 WFDTVYLDDDLRVVKDIRGDYLVVDRASYSWKE 214 >gb|EEE61457.1| hypothetical protein OsJ_15704 [Oryza sativa Japonica Group] Length = 228 Score = 62.0 bits (149), Expect = 2e-07 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -1 Query: 686 WFECIYLDNEIRVAKDIRGDYLVVDRAPYSW 594 WF+ +YLD++IRVAKDIRGDYLVV+RAPYSW Sbjct: 196 WFDTVYLDDDIRVAKDIRGDYLVVERAPYSW 226