BLASTX nr result
ID: Akebia23_contig00033022
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00033022 (401 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME46556.1| hypothetical protein DOTSEDRAFT_70537 [Dothistrom... 56 4e-06 >gb|EME46556.1| hypothetical protein DOTSEDRAFT_70537 [Dothistroma septosporum NZE10] Length = 422 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -2 Query: 400 VKLYMKMVFIQFMVALIGLHLMAAEVYLIAGERLAVLVKS 281 +KLY+KMVFIQ V L +HLMAAE+Y+I G+RL+VL KS Sbjct: 364 IKLYVKMVFIQLAVVLTAVHLMAAELYVIGGDRLSVLAKS 403