BLASTX nr result
ID: Akebia23_contig00031287
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00031287 (316 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006857106.1| hypothetical protein AMTR_s00065p00126320 [A... 97 6e-21 ref|XP_003591561.1| hypothetical protein MTR_1g088810 [Medicago ... 63 4e-08 >ref|XP_006857106.1| hypothetical protein AMTR_s00065p00126320 [Amborella trichopoda] gi|548861189|gb|ERN18573.1| hypothetical protein AMTR_s00065p00126320 [Amborella trichopoda] Length = 159 Score = 96.7 bits (239), Expect(2) = 6e-21 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = +1 Query: 127 PPSLELVHSLGDPLLSRSSVCSSFRPVSYISAHCSHLRGSSHLDSTRTLVPRTA 288 PPSLELVHSLGDPLLSRSSV SSFRPVS ISAHCSHL+ S HLDST+TLVPRTA Sbjct: 43 PPSLELVHSLGDPLLSRSSVFSSFRPVSGISAHCSHLQASLHLDSTKTLVPRTA 96 Score = 29.6 bits (65), Expect(2) = 6e-21 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = +2 Query: 47 GSVSYYRSSDKIRTATSLKAWF 112 G VSY SS K RTATSLKAWF Sbjct: 21 GLVSYSCSSYK-RTATSLKAWF 41 >ref|XP_003591561.1| hypothetical protein MTR_1g088810 [Medicago truncatula] gi|355480609|gb|AES61812.1| hypothetical protein MTR_1g088810 [Medicago truncatula] Length = 444 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +1 Query: 79 DSDRHFSESMVLASLSPPSLELVHSLGDPLLSRSS 183 DSDRHFSESMVLA L PPSLEL+HSLGDPLLSR S Sbjct: 149 DSDRHFSESMVLAFLFPPSLELIHSLGDPLLSRWS 183