BLASTX nr result
ID: Akebia23_contig00031143
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00031143 (204 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524280.1| Small glutamine-rich tetratricopeptide repea... 69 9e-10 ref|XP_006852428.1| hypothetical protein AMTR_s00021p00076440 [A... 68 1e-09 ref|XP_004968637.1| PREDICTED: TPR repeat-containing thioredoxin... 68 1e-09 ref|XP_002457127.1| hypothetical protein SORBIDRAFT_03g001720 [S... 68 1e-09 ref|XP_002317465.1| tetratricopeptide repeat-containing family p... 68 1e-09 ref|NP_001130313.1| hypothetical protein [Zea mays] gi|194688818... 68 1e-09 ref|NP_001042410.1| Os01g0218200 [Oryza sativa Japonica Group] g... 68 2e-09 gb|EEE54122.1| hypothetical protein OsJ_00894 [Oryza sativa Japo... 68 2e-09 ref|XP_006306910.1| hypothetical protein CARUB_v10008469mg [Caps... 67 2e-09 ref|NP_175737.1| TPR repeat-containing thioredoxin TTL1 [Arabido... 67 3e-09 ref|XP_002891741.1| hypothetical protein ARALYDRAFT_892363 [Arab... 67 3e-09 ref|XP_007149399.1| hypothetical protein PHAVU_005G067000g [Phas... 67 3e-09 ref|XP_007021713.1| Tetratricopetide-repeat thioredoxin-like 1 i... 67 3e-09 ref|XP_002283097.2| PREDICTED: TPR repeat-containing thioredoxin... 67 3e-09 ref|XP_003541820.1| PREDICTED: TPR repeat-containing thioredoxin... 67 3e-09 emb|CBI20201.3| unnamed protein product [Vitis vinifera] 67 3e-09 gb|ACU18444.1| unknown [Glycine max] 67 3e-09 ref|XP_007133199.1| hypothetical protein PHAVU_011G160000g [Phas... 66 4e-09 ref|XP_006392803.1| hypothetical protein EUTSA_v10011281mg [Eutr... 66 4e-09 gb|AFW61905.1| hypothetical protein ZEAMMB73_870729 [Zea mays] g... 66 4e-09 >ref|XP_002524280.1| Small glutamine-rich tetratricopeptide repeat-containing protein A, putative [Ricinus communis] gi|223536471|gb|EEF38119.1| Small glutamine-rich tetratricopeptide repeat-containing protein A, putative [Ricinus communis] Length = 640 Score = 68.6 bits (166), Expect = 9e-10 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -3 Query: 202 ENVRIVPTLKIYKNGGKVKEMICPSHQVLEYSVRHYGF 89 EN+RIVPT KIYKNG +VKE++CPSH +LE+SVRHY F Sbjct: 603 ENIRIVPTFKIYKNGSRVKEIVCPSHDMLEHSVRHYSF 640 >ref|XP_006852428.1| hypothetical protein AMTR_s00021p00076440 [Amborella trichopoda] gi|548856039|gb|ERN13895.1| hypothetical protein AMTR_s00021p00076440 [Amborella trichopoda] Length = 671 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -3 Query: 202 ENVRIVPTLKIYKNGGKVKEMICPSHQVLEYSVRHY 95 ENVRIVPT KIYKNG +VKEMICP+ QVLEYSVRHY Sbjct: 634 ENVRIVPTFKIYKNGCRVKEMICPTEQVLEYSVRHY 669 >ref|XP_004968637.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Setaria italica] Length = 677 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 202 ENVRIVPTLKIYKNGGKVKEMICPSHQVLEYSVRHYG 92 ENVR +PT KIYKNG +VKEMICPS Q+LEYSVRHYG Sbjct: 640 ENVRTIPTFKIYKNGMRVKEMICPSQQLLEYSVRHYG 676 >ref|XP_002457127.1| hypothetical protein SORBIDRAFT_03g001720 [Sorghum bicolor] gi|241929102|gb|EES02247.1| hypothetical protein SORBIDRAFT_03g001720 [Sorghum bicolor] Length = 684 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 202 ENVRIVPTLKIYKNGGKVKEMICPSHQVLEYSVRHYG 92 ENVR +PT KIYKNG +VKEMICPS Q+LEYSVRHYG Sbjct: 647 ENVRTIPTFKIYKNGMRVKEMICPSQQLLEYSVRHYG 683 >ref|XP_002317465.1| tetratricopeptide repeat-containing family protein [Populus trichocarpa] gi|222860530|gb|EEE98077.1| tetratricopeptide repeat-containing family protein [Populus trichocarpa] Length = 698 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -3 Query: 202 ENVRIVPTLKIYKNGGKVKEMICPSHQVLEYSVRHYGF 89 E+VRIVPT KIYKNG +VKE++CPSH VLE+SVRHY F Sbjct: 661 EDVRIVPTFKIYKNGNRVKEIVCPSHDVLEHSVRHYSF 698 >ref|NP_001130313.1| hypothetical protein [Zea mays] gi|194688818|gb|ACF78493.1| unknown [Zea mays] gi|413947748|gb|AFW80397.1| hypothetical protein ZEAMMB73_358491 [Zea mays] Length = 675 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 202 ENVRIVPTLKIYKNGGKVKEMICPSHQVLEYSVRHYG 92 ENVR VPT KIYKNG +VKEMICPS Q+LEYSVRHYG Sbjct: 638 ENVRTVPTFKIYKNGIRVKEMICPSQQLLEYSVRHYG 674 >ref|NP_001042410.1| Os01g0218200 [Oryza sativa Japonica Group] gi|56201618|dbj|BAD73065.1| tetratricopeptide repeat protein -like [Oryza sativa Japonica Group] gi|56784083|dbj|BAD81412.1| tetratricopeptide repeat protein -like [Oryza sativa Japonica Group] gi|113531941|dbj|BAF04324.1| Os01g0218200 [Oryza sativa Japonica Group] Length = 672 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 202 ENVRIVPTLKIYKNGGKVKEMICPSHQVLEYSVRHYG 92 ENVR VPT KIYKNG +VKEMICPS Q+LEYSVRHYG Sbjct: 635 ENVRTVPTFKIYKNGTRVKEMICPSLQLLEYSVRHYG 671 >gb|EEE54122.1| hypothetical protein OsJ_00894 [Oryza sativa Japonica Group] Length = 473 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 202 ENVRIVPTLKIYKNGGKVKEMICPSHQVLEYSVRHYG 92 ENVR VPT KIYKNG +VKEMICPS Q+LEYSVRHYG Sbjct: 436 ENVRTVPTFKIYKNGTRVKEMICPSLQLLEYSVRHYG 472 >ref|XP_006306910.1| hypothetical protein CARUB_v10008469mg [Capsella rubella] gi|482575621|gb|EOA39808.1| hypothetical protein CARUB_v10008469mg [Capsella rubella] Length = 695 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -3 Query: 202 ENVRIVPTLKIYKNGGKVKEMICPSHQVLEYSVRHY 95 ENVR+VPT+KIYKNG +VKE++CPS +VLEYSVRHY Sbjct: 658 ENVRVVPTVKIYKNGSRVKEIVCPSREVLEYSVRHY 693 >ref|NP_175737.1| TPR repeat-containing thioredoxin TTL1 [Arabidopsis thaliana] gi|75336154|sp|Q9MAH1.1|TTL1_ARATH RecName: Full=TPR repeat-containing thioredoxin TTL1; AltName: Full=Tetratricopeptide repeat thioredoxin-like 1 gi|7769858|gb|AAF69536.1|AC008007_11 F12M16.20 [Arabidopsis thaliana] gi|30102668|gb|AAP21252.1| At1g53300 [Arabidopsis thaliana] gi|332194799|gb|AEE32920.1| TPR repeat-containing thioredoxin TTL1 [Arabidopsis thaliana] Length = 699 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -3 Query: 202 ENVRIVPTLKIYKNGGKVKEMICPSHQVLEYSVRHY 95 ENVR+VPT+KIYKNG +VKE++CPS +VLEYSVRHY Sbjct: 662 ENVRVVPTVKIYKNGSRVKEIVCPSKEVLEYSVRHY 697 >ref|XP_002891741.1| hypothetical protein ARALYDRAFT_892363 [Arabidopsis lyrata subsp. lyrata] gi|297337583|gb|EFH68000.1| hypothetical protein ARALYDRAFT_892363 [Arabidopsis lyrata subsp. lyrata] Length = 688 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -3 Query: 202 ENVRIVPTLKIYKNGGKVKEMICPSHQVLEYSVRHY 95 ENVR+VPT+KIYKNG +VKE++CPS +VLEYSVRHY Sbjct: 651 ENVRVVPTVKIYKNGSRVKEIVCPSKEVLEYSVRHY 686 >ref|XP_007149399.1| hypothetical protein PHAVU_005G067000g [Phaseolus vulgaris] gi|561022663|gb|ESW21393.1| hypothetical protein PHAVU_005G067000g [Phaseolus vulgaris] Length = 688 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -3 Query: 202 ENVRIVPTLKIYKNGGKVKEMICPSHQVLEYSVRHYGF 89 ENVRIVPT KIYKNG +VKE++CPS ++LE+SVRHY F Sbjct: 651 ENVRIVPTFKIYKNGSRVKEIVCPSREMLEHSVRHYSF 688 >ref|XP_007021713.1| Tetratricopetide-repeat thioredoxin-like 1 isoform 1 [Theobroma cacao] gi|508721341|gb|EOY13238.1| Tetratricopetide-repeat thioredoxin-like 1 isoform 1 [Theobroma cacao] Length = 698 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -3 Query: 202 ENVRIVPTLKIYKNGGKVKEMICPSHQVLEYSVRHYGF 89 ENVRIVPT KIYKNG +VKE++CPS ++LE+SVRHY F Sbjct: 661 ENVRIVPTFKIYKNGSRVKEIVCPSREMLEHSVRHYSF 698 >ref|XP_002283097.2| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Vitis vinifera] Length = 656 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -3 Query: 202 ENVRIVPTLKIYKNGGKVKEMICPSHQVLEYSVRHYGF 89 ENVRI+PT KIYKNG +VKE+ICP+ +VLE SVRHYGF Sbjct: 619 ENVRILPTFKIYKNGSRVKEIICPTREVLESSVRHYGF 656 >ref|XP_003541820.1| PREDICTED: TPR repeat-containing thioredoxin TTL1 [Glycine max] Length = 692 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -3 Query: 202 ENVRIVPTLKIYKNGGKVKEMICPSHQVLEYSVRHYGF 89 ENVRIVPT KIYKNG ++KE++CPSH +LE+SVRHY F Sbjct: 655 ENVRIVPTFKIYKNGCRLKEIVCPSHDMLEHSVRHYSF 692 >emb|CBI20201.3| unnamed protein product [Vitis vinifera] Length = 645 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -3 Query: 202 ENVRIVPTLKIYKNGGKVKEMICPSHQVLEYSVRHYGF 89 ENVRI+PT KIYKNG +VKE+ICP+ +VLE SVRHYGF Sbjct: 608 ENVRILPTFKIYKNGSRVKEIICPTREVLESSVRHYGF 645 >gb|ACU18444.1| unknown [Glycine max] Length = 377 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -3 Query: 202 ENVRIVPTLKIYKNGGKVKEMICPSHQVLEYSVRHYGF 89 ENVRIVPT KIYKNG ++KE++CPSH +LE+SVRHY F Sbjct: 340 ENVRIVPTFKIYKNGCRLKEIVCPSHDMLEHSVRHYSF 377 >ref|XP_007133199.1| hypothetical protein PHAVU_011G160000g [Phaseolus vulgaris] gi|561006199|gb|ESW05193.1| hypothetical protein PHAVU_011G160000g [Phaseolus vulgaris] Length = 679 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -3 Query: 202 ENVRIVPTLKIYKNGGKVKEMICPSHQVLEYSVRHY 95 ENVR+VPT KIYKNG +VKE+ICPSH +LE+S+RHY Sbjct: 642 ENVRVVPTFKIYKNGSRVKEIICPSHDMLEHSIRHY 677 >ref|XP_006392803.1| hypothetical protein EUTSA_v10011281mg [Eutrema salsugineum] gi|557089381|gb|ESQ30089.1| hypothetical protein EUTSA_v10011281mg [Eutrema salsugineum] Length = 689 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -3 Query: 202 ENVRIVPTLKIYKNGGKVKEMICPSHQVLEYSVRHY 95 ENVR+VPT+KIYKNG +VKE++CPS +VLEYSVRHY Sbjct: 652 ENVRVVPTVKIYKNGTRVKEIVCPSKEVLEYSVRHY 687 >gb|AFW61905.1| hypothetical protein ZEAMMB73_870729 [Zea mays] gi|414875705|tpg|DAA52836.1| TPA: hypothetical protein ZEAMMB73_661523 [Zea mays] Length = 670 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 202 ENVRIVPTLKIYKNGGKVKEMICPSHQVLEYSVRHYG 92 ENVR +PT KIYKNG +VKEMICPS Q+LEYSVRH+G Sbjct: 633 ENVRTIPTFKIYKNGIRVKEMICPSQQLLEYSVRHFG 669