BLASTX nr result
ID: Akebia23_contig00030905
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00030905 (265 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB52218.1| Y1 protein [Silene latifolia] 60 2e-07 emb|CAB52261.1| Y1 protein [Silene latifolia] 60 2e-07 ref|XP_006426544.1| hypothetical protein CICLE_v10025540mg [Citr... 60 2e-07 emb|CAB52219.1| X1 protein [Silene latifolia] 60 2e-07 emb|CAC81926.1| putative WD-repeat protein [Silene latifolia] 60 2e-07 emb|CAC81927.1| putative WD-repeat protein [Silene latifolia] 60 2e-07 emb|CAF74832.1| putative WD repeat protein [Silene dioica] gi|57... 60 2e-07 gb|AAM23296.1| X1 protein [Silene latifolia] gi|21386780|gb|AAM2... 60 2e-07 ref|XP_006385364.1| WD-40 repeat protein MSI4 [Populus trichocar... 59 5e-07 emb|CAR63186.1| SlX1/Y1 protein [Silene nutans] gi|197115078|emb... 59 5e-07 emb|CAR63183.1| SlX1/Y1 protein [Silene acaulis] gi|197115070|em... 59 5e-07 emb|CAR63182.1| SlX1/Y1 protein [Silene vulgaris] 59 5e-07 emb|CAR63181.1| SlX1/Y1 protein [Silene vulgaris] 59 5e-07 emb|CAR63180.1| SlX1/Y1 protein [Silene vulgaris] 59 5e-07 emb|CAR63178.1| SlX1/Y1 protein [Silene conoidea] 59 5e-07 emb|CAR63177.1| SlX1/Y1 protein [Silene conica] 59 5e-07 emb|CAR63176.1| SlX1/Y1 protein [Silene pendula] 59 5e-07 emb|CAF74836.1| putative WD repeat protein [Silene noctiflora] 59 5e-07 gb|AAM23302.1| XY1 protein [Silene flos-jovis] 59 5e-07 gb|AAL92489.1| SlX1-like protein [Silene conica] 59 5e-07 >emb|CAB52218.1| Y1 protein [Silene latifolia] Length = 472 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/33 (84%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = +2 Query: 2 EKAHNADLHCVDWNPHDVNLILTGYG-SSINVF 97 EKAHNADLHCVDWNPHD NLILTG SSIN+F Sbjct: 286 EKAHNADLHCVDWNPHDENLILTGSADSSINLF 318 >emb|CAB52261.1| Y1 protein [Silene latifolia] Length = 428 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/33 (84%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = +2 Query: 2 EKAHNADLHCVDWNPHDVNLILTGYG-SSINVF 97 EKAHNADLHCVDWNPHD NLILTG SSIN+F Sbjct: 242 EKAHNADLHCVDWNPHDENLILTGSADSSINLF 274 >ref|XP_006426544.1| hypothetical protein CICLE_v10025540mg [Citrus clementina] gi|557528534|gb|ESR39784.1| hypothetical protein CICLE_v10025540mg [Citrus clementina] Length = 326 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +2 Query: 2 EKAHNADLHCVDWNPHDVNLILTGY 76 EKAHNAD+HCVDWNPHDVNLILTGY Sbjct: 291 EKAHNADIHCVDWNPHDVNLILTGY 315 >emb|CAB52219.1| X1 protein [Silene latifolia] Length = 472 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/33 (84%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = +2 Query: 2 EKAHNADLHCVDWNPHDVNLILTGYG-SSINVF 97 EKAHNADLHCVDWNPHD NLILTG SSIN+F Sbjct: 286 EKAHNADLHCVDWNPHDENLILTGSADSSINLF 318 >emb|CAC81926.1| putative WD-repeat protein [Silene latifolia] Length = 429 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/33 (84%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = +2 Query: 2 EKAHNADLHCVDWNPHDVNLILTGYG-SSINVF 97 EKAHNADLHCVDWNPHD NLILTG SSIN+F Sbjct: 243 EKAHNADLHCVDWNPHDENLILTGSADSSINLF 275 >emb|CAC81927.1| putative WD-repeat protein [Silene latifolia] Length = 473 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/33 (84%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = +2 Query: 2 EKAHNADLHCVDWNPHDVNLILTGYG-SSINVF 97 EKAHNADLHCVDWNPHD NLILTG SSIN+F Sbjct: 287 EKAHNADLHCVDWNPHDENLILTGSADSSINLF 319 >emb|CAF74832.1| putative WD repeat protein [Silene dioica] gi|57282859|emb|CAF74833.1| putative WD repeat protein [Silene dioica] gi|57282861|emb|CAF74834.1| putative WD repeat protein [Silene diclinis] Length = 458 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/33 (84%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = +2 Query: 2 EKAHNADLHCVDWNPHDVNLILTGYG-SSINVF 97 EKAHNADLHCVDWNPHD NLILTG SSIN+F Sbjct: 278 EKAHNADLHCVDWNPHDENLILTGSADSSINLF 310 >gb|AAM23296.1| X1 protein [Silene latifolia] gi|21386780|gb|AAM23297.1| Y1 protein [Silene latifolia] gi|21386794|gb|AAM23304.1| X1 protein [Silene dioica] gi|21386796|gb|AAM23305.1| Y1 protein [Silene dioica] Length = 286 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/33 (84%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = +2 Query: 2 EKAHNADLHCVDWNPHDVNLILTGYG-SSINVF 97 EKAHNADLHCVDWNPHD NLILTG SSIN+F Sbjct: 170 EKAHNADLHCVDWNPHDENLILTGSADSSINLF 202 >ref|XP_006385364.1| WD-40 repeat protein MSI4 [Populus trichocarpa] gi|550342306|gb|ERP63161.1| WD-40 repeat protein MSI4 [Populus trichocarpa] Length = 465 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/33 (78%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = +2 Query: 2 EKAHNADLHCVDWNPHDVNLILTGYG-SSINVF 97 EKAHNADLHCVDWNPHDVNLILTG +S+++F Sbjct: 288 EKAHNADLHCVDWNPHDVNLILTGSADNSVHMF 320 >emb|CAR63186.1| SlX1/Y1 protein [Silene nutans] gi|197115078|emb|CAR63188.1| SlX1/Y1 protein [Silene nutans] gi|197115082|emb|CAR63190.1| SlX1/Y1-like protein [Silene nutans] Length = 147 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/33 (81%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = +2 Query: 2 EKAHNADLHCVDWNPHDVNLILTGYG-SSINVF 97 EKAHNADLHCVDWNPHD NLILTG +SIN+F Sbjct: 2 EKAHNADLHCVDWNPHDENLILTGSADNSINLF 34 >emb|CAR63183.1| SlX1/Y1 protein [Silene acaulis] gi|197115070|emb|CAR63184.1| SlX1/Y1 protein [Silene acaulis] Length = 379 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/33 (81%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = +2 Query: 2 EKAHNADLHCVDWNPHDVNLILTGYG-SSINVF 97 EKAHNADLHCVDWNPHD NLILTG +SIN+F Sbjct: 222 EKAHNADLHCVDWNPHDENLILTGSADNSINLF 254 >emb|CAR63182.1| SlX1/Y1 protein [Silene vulgaris] Length = 352 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/33 (81%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = +2 Query: 2 EKAHNADLHCVDWNPHDVNLILTGYG-SSINVF 97 EKAHNADLHCVDWNPHD NLILTG +SIN+F Sbjct: 241 EKAHNADLHCVDWNPHDENLILTGSADNSINLF 273 >emb|CAR63181.1| SlX1/Y1 protein [Silene vulgaris] Length = 313 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/33 (81%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = +2 Query: 2 EKAHNADLHCVDWNPHDVNLILTGYG-SSINVF 97 EKAHNADLHCVDWNPHD NLILTG +SIN+F Sbjct: 241 EKAHNADLHCVDWNPHDENLILTGSADNSINLF 273 >emb|CAR63180.1| SlX1/Y1 protein [Silene vulgaris] Length = 119 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/33 (81%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = +2 Query: 2 EKAHNADLHCVDWNPHDVNLILTGYG-SSINVF 97 EKAHNADLHCVDWNPHD NLILTG +SIN+F Sbjct: 3 EKAHNADLHCVDWNPHDENLILTGSADNSINLF 35 >emb|CAR63178.1| SlX1/Y1 protein [Silene conoidea] Length = 398 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/33 (81%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = +2 Query: 2 EKAHNADLHCVDWNPHDVNLILTGYG-SSINVF 97 EKAHNADLHCVDWNPHD NLILTG +SIN+F Sbjct: 241 EKAHNADLHCVDWNPHDENLILTGSADNSINLF 273 >emb|CAR63177.1| SlX1/Y1 protein [Silene conica] Length = 398 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/33 (81%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = +2 Query: 2 EKAHNADLHCVDWNPHDVNLILTGYG-SSINVF 97 EKAHNADLHCVDWNPHD NLILTG +SIN+F Sbjct: 241 EKAHNADLHCVDWNPHDENLILTGSADNSINLF 273 >emb|CAR63176.1| SlX1/Y1 protein [Silene pendula] Length = 371 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/33 (81%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = +2 Query: 2 EKAHNADLHCVDWNPHDVNLILTGYG-SSINVF 97 EKAHNADLHCVDWNPHD NLILTG +SIN+F Sbjct: 241 EKAHNADLHCVDWNPHDENLILTGSADNSINLF 273 >emb|CAF74836.1| putative WD repeat protein [Silene noctiflora] Length = 458 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/33 (81%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = +2 Query: 2 EKAHNADLHCVDWNPHDVNLILTGYG-SSINVF 97 EKAHNADLHCVDWNPHD NLILTG +SIN+F Sbjct: 278 EKAHNADLHCVDWNPHDENLILTGSADNSINLF 310 >gb|AAM23302.1| XY1 protein [Silene flos-jovis] Length = 286 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/33 (81%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = +2 Query: 2 EKAHNADLHCVDWNPHDVNLILTGYG-SSINVF 97 EKAHNADLHCVDWNPHD NLILTG +SIN+F Sbjct: 170 EKAHNADLHCVDWNPHDENLILTGSADNSINLF 202 >gb|AAL92489.1| SlX1-like protein [Silene conica] Length = 321 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/33 (81%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = +2 Query: 2 EKAHNADLHCVDWNPHDVNLILTGYG-SSINVF 97 EKAHNADLHCVDWNPHD NLILTG +SIN+F Sbjct: 181 EKAHNADLHCVDWNPHDENLILTGSADNSINLF 213