BLASTX nr result
ID: Akebia23_contig00030659
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00030659 (257 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_010118018.1| hypothetical protein, partial [Acinetobacter... 56 4e-06 >ref|WP_010118018.1| hypothetical protein, partial [Acinetobacter sp. P8-3-8] Length = 121 Score = 56.2 bits (134), Expect = 4e-06 Identities = 33/65 (50%), Positives = 39/65 (60%), Gaps = 4/65 (6%) Frame = +2 Query: 2 PRISPLAIEYECPRPPLFII-TVPLKRPIETRVLFYYSMLKHSG---KHACFEHSDLFKV 169 PRISPLA +YECPRP L I+ +VP IE R YS++ G ACFEHS+ FKV Sbjct: 21 PRISPLAAQYECPRPSLLIMASVPKTNKIEPR---SYSIIPSCGIQAARACFEHSNFFKV 77 Query: 170 KVRVP 184 P Sbjct: 78 NASGP 82