BLASTX nr result
ID: Akebia23_contig00030511
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00030511 (1062 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCH50976.1| T4.15 [Malus x robusta] 60 2e-06 gb|ABB00038.1| reverse transcriptase family member [Glycine max] 58 6e-06 gb|EXB94379.1| E3 ubiquitin-protein ligase UPL6 [Morus notabilis] 57 1e-05 >emb|CCH50976.1| T4.15 [Malus x robusta] Length = 986 Score = 60.1 bits (144), Expect = 2e-06 Identities = 27/65 (41%), Positives = 42/65 (64%) Frame = -3 Query: 934 YKA*CWEIKKQHFDIMGIAYLRMM*YTTGKTREDKMKTEHVF*KVELPLMCYKLKESQLR 755 Y CW +K QH MG+A +RM+ + G TR+DK++ E + KV + + K++E+QLR Sbjct: 856 YGTECWAVKHQHVHKMGVAEMRMLRWMCGHTRKDKIRNEDIRGKVGVAEIQGKMRENQLR 915 Query: 754 WFDHM 740 WF H+ Sbjct: 916 WFGHV 920 >gb|ABB00038.1| reverse transcriptase family member [Glycine max] Length = 377 Score = 58.2 bits (139), Expect = 6e-06 Identities = 25/65 (38%), Positives = 43/65 (66%) Frame = -3 Query: 934 YKA*CWEIKKQHFDIMGIAYLRMM*YTTGKTREDKMKTEHVF*KVELPLMCYKLKESQLR 755 Y CW +K QH + +G+A +RM+ + GKTR+DK++ E + +V + + K+ E++LR Sbjct: 248 YGTECWAVKSQHENKVGVAEMRMLRWMCGKTRQDKIRNEAIRERVGVAPIVEKMVENRLR 307 Query: 754 WFDHM 740 WF H+ Sbjct: 308 WFGHV 312 >gb|EXB94379.1| E3 ubiquitin-protein ligase UPL6 [Morus notabilis] Length = 1413 Score = 57.4 bits (137), Expect = 1e-05 Identities = 26/65 (40%), Positives = 43/65 (66%) Frame = -3 Query: 934 YKA*CWEIKKQHFDIMGIAYLRMM*YTTGKTREDKMKTEHVF*KVELPLMCYKLKESQLR 755 Y + CW IK+QH M +A +RM+ + +G+TR D++K E + KV + + K++E +LR Sbjct: 969 YGSKCWAIKRQHISKMSVAEMRMLRWMSGQTRMDRIKNEVIRSKVGVAPIEDKVREGRLR 1028 Query: 754 WFDHM 740 WF H+ Sbjct: 1029 WFGHV 1033