BLASTX nr result
ID: Akebia23_contig00030491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00030491 (618 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006852995.1| hypothetical protein AMTR_s05571p00001370 [A... 69 1e-09 >ref|XP_006852995.1| hypothetical protein AMTR_s05571p00001370 [Amborella trichopoda] gi|548856620|gb|ERN14462.1| hypothetical protein AMTR_s05571p00001370 [Amborella trichopoda] Length = 142 Score = 68.6 bits (166), Expect = 1e-09 Identities = 35/92 (38%), Positives = 60/92 (65%), Gaps = 1/92 (1%) Frame = -2 Query: 455 ADVVTYHQDTIGDLVRELRNQQNKPLPDEPHRIQSAIE-RVEERLRGTLSLAELTDEIKN 279 A+ +T++++ I DL+ ELR+++ PLPDEP+R+Q IE VE+ G + L +E++ Sbjct: 35 AERLTFYENAIHDLILELRDEEKIPLPDEPYRVQRIIEVLVEKEEEGFDGIHLLYEEMQK 94 Query: 278 KGPLSRGYFYFNYYFDLEVTDDKDGVTEEELK 183 +SRGY +FN F L++ + + VTEE+ + Sbjct: 95 NRLMSRGYLHFNVKFALDLEVEGEDVTEEDFR 126