BLASTX nr result
ID: Akebia23_contig00030427
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00030427 (361 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001791607.1| hypothetical protein SNOG_00941 [Phaeosphaer... 58 2e-06 >ref|XP_001791607.1| hypothetical protein SNOG_00941 [Phaeosphaeria nodorum SN15] gi|111071316|gb|EAT92436.1| hypothetical protein SNOG_00941 [Phaeosphaeria nodorum SN15] Length = 325 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/52 (57%), Positives = 31/52 (59%) Frame = -2 Query: 360 KVVVEKSPYTYERVASPAFXXXXXXXXXXXXXPSPGHGTSGTAYEPFRQSHV 205 KV VEK+PYTYERVASPAF G G SGTAYEPFR S V Sbjct: 274 KVSVEKTPYTYERVASPAFPAQHGAPAQHSGFVGAGQGQSGTAYEPFRGSRV 325