BLASTX nr result
ID: Akebia23_contig00030054
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00030054 (226 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCH50976.1| T4.15 [Malus x robusta] 60 4e-07 emb|CBL94163.1| putative RNA-directed DNA polymerase (Reverse tr... 59 9e-07 gb|EMS58462.1| hypothetical protein TRIUR3_26054 [Triticum urartu] 56 6e-06 >emb|CCH50976.1| T4.15 [Malus x robusta] Length = 986 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/65 (46%), Positives = 42/65 (64%), Gaps = 3/65 (4%) Frame = +1 Query: 13 YNGLGTKD---DV*KLSGIRGRKTKDLDNVRCIKGEDEMVMSRDEEIKKRCRGYF*KLLN 183 Y L TK+ D+ KL+ R +KT+DL+ VRCIK ED V++ + +K R RGYF L N Sbjct: 474 YKRLDTKEGELDIYKLARAREKKTRDLNQVRCIKDEDGKVLATENAVKDRWRGYFHNLFN 533 Query: 184 DDHQR 198 + H+R Sbjct: 534 EGHER 538 >emb|CBL94163.1| putative RNA-directed DNA polymerase (Reverse transcriptase) [Malus domestica] Length = 622 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/65 (44%), Positives = 42/65 (64%), Gaps = 3/65 (4%) Frame = +1 Query: 13 YNGLGTKD---DV*KLSGIRGRKTKDLDNVRCIKGEDEMVMSRDEEIKKRCRGYF*KLLN 183 Y L TK+ D+ KL+ R +KT+DL+ VRCIK ED V++ + +K + RGYF L N Sbjct: 78 YKRLDTKEGELDIYKLARAREKKTRDLNQVRCIKDEDGKVLATENAVKDKWRGYFHNLFN 137 Query: 184 DDHQR 198 + H+R Sbjct: 138 EGHER 142 >gb|EMS58462.1| hypothetical protein TRIUR3_26054 [Triticum urartu] Length = 1206 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/64 (45%), Positives = 42/64 (65%), Gaps = 3/64 (4%) Frame = +1 Query: 13 YNGLGTKD---DV*KLSGIRGRKTKDLDNVRCIKGEDEMVMSRDEEIKKRCRGYF*KLLN 183 Y LGTK+ D+ K++ IR RKT+D+ V+CIK ++ +DEEIK R R YF KL N Sbjct: 92 YQRLGTKEGERDIYKMAKIRERKTRDIGQVKCIKDGAGQLLVKDEEIKHRWREYFDKLFN 151 Query: 184 DDHQ 195 +++ Sbjct: 152 GENE 155