BLASTX nr result
ID: Akebia23_contig00029417
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00029417 (310 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007040635.1| SNARE associated Golgi protein family [Theob... 59 7e-07 ref|XP_002278896.1| PREDICTED: uncharacterized membrane protein ... 57 3e-06 >ref|XP_007040635.1| SNARE associated Golgi protein family [Theobroma cacao] gi|508777880|gb|EOY25136.1| SNARE associated Golgi protein family [Theobroma cacao] Length = 251 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = +1 Query: 175 MENREEIAFGRTQSKFPLTFWEVTIASAVVLSFVLGLVCVYLTMP 309 ME REE+ ++ +FPL+FWEVT+AS VV++FVLGLV VYLTMP Sbjct: 1 MEGREEMK--GSKPRFPLSFWEVTVASTVVMAFVLGLVGVYLTMP 43 >ref|XP_002278896.1| PREDICTED: uncharacterized membrane protein At4g09580 [Vitis vinifera] Length = 254 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 211 QSKFPLTFWEVTIASAVVLSFVLGLVCVYLTMP 309 + +FPLTFWEVT ASAVV +FVLGL CVYLTMP Sbjct: 14 EGRFPLTFWEVTGASAVVGAFVLGLACVYLTMP 46