BLASTX nr result
ID: Akebia23_contig00028994
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00028994 (515 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007021653.1| TCP family transcription factor 4, putative ... 90 3e-16 ref|XP_002519561.1| conserved hypothetical protein [Ricinus comm... 87 3e-15 gb|AAG43412.1| cycloidea [Solanum lycopersicum] 84 3e-14 ref|XP_007211840.1| hypothetical protein PRUPE_ppa004661mg [Prun... 78 1e-12 ref|XP_006594737.1| PREDICTED: transcription factor PCF5-like [G... 77 2e-12 ref|XP_006348284.1| PREDICTED: transcription factor TCP4-like [S... 77 2e-12 ref|XP_007161598.1| hypothetical protein PHAVU_001G082900g [Phas... 77 2e-12 ref|XP_006451744.1| hypothetical protein CICLE_v10008390mg [Citr... 77 2e-12 ref|XP_006407022.1| hypothetical protein EUTSA_v10020786mg [Eutr... 77 2e-12 ref|XP_006370036.1| hypothetical protein POPTR_0001s38480g [Popu... 77 2e-12 ref|XP_006852505.1| hypothetical protein AMTR_s00021p00158020 [A... 77 2e-12 ref|XP_004510040.1| PREDICTED: transcription factor TCP4-like [C... 77 2e-12 ref|XP_006297817.1| hypothetical protein CARUB_v10013851mg [Caps... 77 2e-12 gb|AGH06161.1| TCP trancription factor [Petunia hybrid cultivar] 77 2e-12 ref|XP_004137216.1| PREDICTED: transcription factor TCP4-like [C... 77 2e-12 dbj|BAA97066.1| unnamed protein product [Arabidopsis thaliana] 77 2e-12 emb|CAD19990.1| TCP1 protein [Lupinus albus] 77 2e-12 gb|AEM05868.1| teosinte ranched/cycloidea/pcf family member [Lit... 77 2e-12 ref|XP_003634670.1| PREDICTED: transcription factor TCP4-like [V... 77 2e-12 ref|XP_003540480.1| PREDICTED: transcription factor TCP4-like [G... 77 2e-12 >ref|XP_007021653.1| TCP family transcription factor 4, putative [Theobroma cacao] gi|508721281|gb|EOY13178.1| TCP family transcription factor 4, putative [Theobroma cacao] Length = 592 Score = 90.1 bits (222), Expect = 3e-16 Identities = 73/206 (35%), Positives = 87/206 (42%), Gaps = 66/206 (32%) Frame = +1 Query: 94 KLEERKKKGLSLDPQSNHYHHLQT------------HLHQ------------------EQ 183 +LE+ K K LSLDPQ NH+HH Q H HQ E+ Sbjct: 18 QLEQEKHKDLSLDPQRNHHHHQQRQQQQQQHHTPHHHQHQNPILNSSHIGVAEGGGEEEE 77 Query: 184 PP----------------------QQG----SSTDTQLITR-------PLKKRSYFSPTS 264 PP QQG +S D Q+I + P KKR+YF+ +S Sbjct: 78 PPKNQQENFFSHHHQYLQETQSQQQQGQRLYASLDRQVIQQQEQESPQPPKKRTYFASSS 137 Query: 265 VD---DGTLGEMMMVGENQHHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSTGRKDRHS 435 + +G++ H RSTGRKDRHS Sbjct: 138 SSAFGSKSTEHARTMGDSHHQAATSSRLGIRHTGGEIVEVQGGHIV----RSTGRKDRHS 193 Query: 436 KVCTAKGPRDRRVRLSAHTAIQFYDV 513 KVCTAKGPRDRRVRLSAHTAIQFYDV Sbjct: 194 KVCTAKGPRDRRVRLSAHTAIQFYDV 219 >ref|XP_002519561.1| conserved hypothetical protein [Ricinus communis] gi|223541258|gb|EEF42810.1| conserved hypothetical protein [Ricinus communis] Length = 595 Score = 86.7 bits (213), Expect = 3e-15 Identities = 57/145 (39%), Positives = 69/145 (47%), Gaps = 19/145 (13%) Frame = +1 Query: 136 QSNHYHHLQT-------HLHQEQPPQQGSS--------TDTQLITRPLKKRSYFSPTS-- 264 Q +HY+H + +L QP Q+ S Q+ P KKRS+FS +S Sbjct: 103 QPDHYYHQELPFIVHHQYLQTTQPQQEQSQHLYQRLDLQQLQIPLHPPKKRSHFSSSSST 162 Query: 265 --VDDGTLGEMMMVGENQHHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSTGRKDRHSK 438 + + +GE+Q RSTGRKDRHSK Sbjct: 163 SIIQEQGFEYARKMGESQRQHQQQPARSSRLGTRNTVGEIVEVQGGHIVRSTGRKDRHSK 222 Query: 439 VCTAKGPRDRRVRLSAHTAIQFYDV 513 VCTAKGPRDRRVRLSAHTAIQFYDV Sbjct: 223 VCTAKGPRDRRVRLSAHTAIQFYDV 247 >gb|AAG43412.1| cycloidea [Solanum lycopersicum] Length = 396 Score = 83.6 bits (205), Expect = 3e-14 Identities = 62/170 (36%), Positives = 73/170 (42%), Gaps = 33/170 (19%) Frame = +1 Query: 103 ERKKKGLSLDPQSNHYHHLQTHLHQ----------EQPPQQGSSTDTQLITRP--LKKRS 246 E KGLSLDPQ N H + +Q E+ QQ S + QL P +++ Sbjct: 4 EIANKGLSLDPQRNQQQHYHLNQNQNQNQDSVGKEEEENQQQSENEPQLYLHPHNQQQQP 63 Query: 247 YFS------------------PTSVDDGTLGEMMMVGENQHHXXXXXXXXXXXXXXXXXX 372 +F+ PT L +G+N H Sbjct: 64 FFNQHHLIYGRLDSQQLLPPQPTPKKRSYLPSTSSLGQNVEHAAALRGKMAETSRLGIRN 123 Query: 373 XXXXXXXXXXX---RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 513 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV Sbjct: 124 TVGEIVEVQGGHIVRSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 173 >ref|XP_007211840.1| hypothetical protein PRUPE_ppa004661mg [Prunus persica] gi|462407705|gb|EMJ13039.1| hypothetical protein PRUPE_ppa004661mg [Prunus persica] Length = 497 Score = 78.2 bits (191), Expect = 1e-12 Identities = 60/160 (37%), Positives = 73/160 (45%), Gaps = 10/160 (6%) Frame = +1 Query: 64 NPINQTVKNQKLEERKKKGLSLDPQSNHYHHLQTHLHQEQPPQQGSSTDTQLITRPLKKR 243 N IN ++ + +KK S P N LQ Q+Q P KKR Sbjct: 27 NSINNKIRRSEPTSKKKCCSSRSP--NKAAELQAQ--QQQAP---------------KKR 67 Query: 244 SYFSPTSVDDGTLGEMMM------VGENQHHXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 405 ++F+ +S TLGE + +G+ HH Sbjct: 68 NFFTSSS---STLGEQSIEYARSKMGDTHHHHHPEATTSSRLGIRPSSGLSADIVEVVRG 124 Query: 406 ----RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 513 RSTGRKDRHSKVCTAKGPRDRRVRL+AHTAIQFYDV Sbjct: 125 SHIVRSTGRKDRHSKVCTAKGPRDRRVRLAAHTAIQFYDV 164 >ref|XP_006594737.1| PREDICTED: transcription factor PCF5-like [Glycine max] Length = 257 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +1 Query: 406 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 513 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV Sbjct: 19 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 54 >ref|XP_006348284.1| PREDICTED: transcription factor TCP4-like [Solanum tuberosum] Length = 400 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +1 Query: 406 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 513 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV Sbjct: 26 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 61 >ref|XP_007161598.1| hypothetical protein PHAVU_001G082900g [Phaseolus vulgaris] gi|561035062|gb|ESW33592.1| hypothetical protein PHAVU_001G082900g [Phaseolus vulgaris] Length = 371 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +1 Query: 406 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 513 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV Sbjct: 22 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 57 >ref|XP_006451744.1| hypothetical protein CICLE_v10008390mg [Citrus clementina] gi|568864597|ref|XP_006485680.1| PREDICTED: transcription factor TCP4-like [Citrus sinensis] gi|557554970|gb|ESR64984.1| hypothetical protein CICLE_v10008390mg [Citrus clementina] Length = 426 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +1 Query: 406 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 513 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV Sbjct: 33 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 68 >ref|XP_006407022.1| hypothetical protein EUTSA_v10020786mg [Eutrema salsugineum] gi|557108168|gb|ESQ48475.1| hypothetical protein EUTSA_v10020786mg [Eutrema salsugineum] Length = 428 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +1 Query: 406 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 513 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV Sbjct: 47 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 82 >ref|XP_006370036.1| hypothetical protein POPTR_0001s38480g [Populus trichocarpa] gi|550349183|gb|ERP66605.1| hypothetical protein POPTR_0001s38480g [Populus trichocarpa] Length = 414 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +1 Query: 406 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 513 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV Sbjct: 33 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 68 >ref|XP_006852505.1| hypothetical protein AMTR_s00021p00158020 [Amborella trichopoda] gi|548856116|gb|ERN13972.1| hypothetical protein AMTR_s00021p00158020 [Amborella trichopoda] Length = 375 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +1 Query: 406 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 513 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV Sbjct: 23 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 58 >ref|XP_004510040.1| PREDICTED: transcription factor TCP4-like [Cicer arietinum] Length = 405 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +1 Query: 406 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 513 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV Sbjct: 39 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 74 >ref|XP_006297817.1| hypothetical protein CARUB_v10013851mg [Capsella rubella] gi|482566526|gb|EOA30715.1| hypothetical protein CARUB_v10013851mg [Capsella rubella] Length = 406 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +1 Query: 406 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 513 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV Sbjct: 40 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 75 >gb|AGH06161.1| TCP trancription factor [Petunia hybrid cultivar] Length = 418 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +1 Query: 406 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 513 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV Sbjct: 34 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 69 >ref|XP_004137216.1| PREDICTED: transcription factor TCP4-like [Cucumis sativus] gi|449531426|ref|XP_004172687.1| PREDICTED: transcription factor TCP4-like [Cucumis sativus] Length = 428 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +1 Query: 406 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 513 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV Sbjct: 35 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 70 >dbj|BAA97066.1| unnamed protein product [Arabidopsis thaliana] Length = 406 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +1 Query: 406 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 513 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV Sbjct: 27 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 62 >emb|CAD19990.1| TCP1 protein [Lupinus albus] Length = 407 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +1 Query: 406 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 513 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV Sbjct: 36 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 71 >gb|AEM05868.1| teosinte ranched/cycloidea/pcf family member [Lithospermum erythrorhizon] Length = 442 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +1 Query: 406 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 513 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV Sbjct: 30 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 65 >ref|XP_003634670.1| PREDICTED: transcription factor TCP4-like [Vitis vinifera] Length = 398 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +1 Query: 406 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 513 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV Sbjct: 36 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 71 >ref|XP_003540480.1| PREDICTED: transcription factor TCP4-like [Glycine max] Length = 377 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +1 Query: 406 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 513 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV Sbjct: 22 RSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDV 57