BLASTX nr result
ID: Akebia23_contig00027910
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00027910 (225 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007162036.1| hypothetical protein PHAVU_001G118300g [Phas... 61 2e-07 ref|XP_006482028.1| PREDICTED: WAT1-related protein At5g07050-li... 59 7e-07 ref|XP_002517269.1| Auxin-induced protein 5NG4, putative [Ricinu... 58 1e-06 ref|XP_002283348.1| PREDICTED: auxin-induced protein 5NG4 isofor... 57 3e-06 ref|XP_006430497.1| hypothetical protein CICLE_v10012013mg [Citr... 57 4e-06 ref|XP_002308862.2| hypothetical protein POPTR_0006s03200g [Popu... 55 8e-06 >ref|XP_007162036.1| hypothetical protein PHAVU_001G118300g [Phaseolus vulgaris] gi|561035500|gb|ESW34030.1| hypothetical protein PHAVU_001G118300g [Phaseolus vulgaris] Length = 437 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/59 (54%), Positives = 38/59 (64%), Gaps = 4/59 (6%) Frame = -3 Query: 166 CKVSLLLVIFSKNLQSLPR----RKKMENQGLFGNFVQKCKPYIAMTSLQFGYAGMNII 2 C S+ + S + LPR KKME G G+F Q+CKPYIAM SLQFG+AGMNII Sbjct: 19 CSSSVHNSVPSSEYRPLPRTPQREKKMEGDGYCGSFFQRCKPYIAMISLQFGFAGMNII 77 >ref|XP_006482028.1| PREDICTED: WAT1-related protein At5g07050-like [Citrus sinensis] Length = 405 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -3 Query: 100 MENQGLFGNFVQKCKPYIAMTSLQFGYAGMNII 2 ME +G GNF+Q+CKPYIAM SLQFGYAGMNII Sbjct: 1 MEGKGCCGNFLQRCKPYIAMISLQFGYAGMNII 33 >ref|XP_002517269.1| Auxin-induced protein 5NG4, putative [Ricinus communis] gi|223543532|gb|EEF45062.1| Auxin-induced protein 5NG4, putative [Ricinus communis] Length = 372 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -3 Query: 100 MENQGLFGNFVQKCKPYIAMTSLQFGYAGMNII 2 ME G G+F+Q+CKPYIAM SLQFGYAGMNII Sbjct: 1 MEGNGCLGSFIQRCKPYIAMISLQFGYAGMNII 33 >ref|XP_002283348.1| PREDICTED: auxin-induced protein 5NG4 isoform 1 [Vitis vinifera] gi|297741692|emb|CBI32824.3| unnamed protein product [Vitis vinifera] Length = 396 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -3 Query: 100 MENQGLFGNFVQKCKPYIAMTSLQFGYAGMNII 2 ME +G G+F Q+CKPYIAM SLQFGYAGMNII Sbjct: 1 MEGKGCLGSFFQRCKPYIAMISLQFGYAGMNII 33 >ref|XP_006430497.1| hypothetical protein CICLE_v10012013mg [Citrus clementina] gi|557532554|gb|ESR43737.1| hypothetical protein CICLE_v10012013mg [Citrus clementina] Length = 367 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -3 Query: 100 MENQGLFGNFVQKCKPYIAMTSLQFGYAGMNII 2 ME +G NF+Q+CKPYIAM SLQFGYAGMNII Sbjct: 1 MEEKGCCSNFLQRCKPYIAMISLQFGYAGMNII 33 >ref|XP_002308862.2| hypothetical protein POPTR_0006s03200g [Populus trichocarpa] gi|550335355|gb|EEE92385.2| hypothetical protein POPTR_0006s03200g [Populus trichocarpa] Length = 405 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -3 Query: 100 MENQGLFGNFVQKCKPYIAMTSLQFGYAGMNII 2 ME G G++ Q+CKPYIAM SLQFGYAGMNII Sbjct: 1 MEGNGCLGSYFQRCKPYIAMISLQFGYAGMNII 33