BLASTX nr result
ID: Akebia23_contig00027758
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00027758 (268 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006386600.1| hypothetical protein POPTR_0002s16100g [Popu... 56 5e-06 >ref|XP_006386600.1| hypothetical protein POPTR_0002s16100g [Populus trichocarpa] gi|550345124|gb|ERP64397.1| hypothetical protein POPTR_0002s16100g [Populus trichocarpa] Length = 442 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 3 SYSRVLEGLAFNIVSWIEDVLYVDSTTKRQDQ 98 SYSRVLEGLAFNIV+WIEDVL+VD++ + QDQ Sbjct: 411 SYSRVLEGLAFNIVAWIEDVLFVDNSVRTQDQ 442