BLASTX nr result
ID: Akebia23_contig00027732
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00027732 (661 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006840886.1| hypothetical protein AMTR_s00087p00047450 [A... 62 2e-07 ref|XP_002325903.2| hypothetical protein POPTR_0019s08060g [Popu... 60 6e-07 ref|XP_002278837.2| PREDICTED: LOW QUALITY PROTEIN: putative pen... 60 8e-07 ref|XP_002514857.1| pentatricopeptide repeat-containing protein,... 60 8e-07 emb|CBI17645.3| unnamed protein product [Vitis vinifera] 60 8e-07 emb|CAN82640.1| hypothetical protein VITISV_028821 [Vitis vinifera] 60 8e-07 gb|ABK23677.1| unknown [Picea sitchensis] gi|224286876|gb|ACN411... 59 1e-06 ref|XP_006660314.1| PREDICTED: GDT1-like protein 4-like [Oryza b... 58 2e-06 ref|XP_004973981.1| PREDICTED: GDT1-like protein 4-like [Setaria... 58 2e-06 ref|XP_007029388.1| Uncharacterized protein isoform 2, partial [... 58 2e-06 ref|XP_007029387.1| Uncharacterized protein isoform 1 [Theobroma... 58 2e-06 ref|NP_001062312.1| Os08g0528500 [Oryza sativa Japonica Group] g... 58 2e-06 tpg|DAA48176.1| TPA: hypothetical protein ZEAMMB73_131539 [Zea m... 58 2e-06 ref|XP_003572431.1| PREDICTED: GDT1-like protein 4-like [Brachyp... 58 2e-06 ref|XP_002444709.1| hypothetical protein SORBIDRAFT_07g026430 [S... 58 2e-06 ref|NP_001141271.1| hypothetical protein precursor [Zea mays] gi... 58 2e-06 gb|EAZ43426.1| hypothetical protein OsJ_28031 [Oryza sativa Japo... 58 2e-06 sp|A2YXC7.1|GDT14_ORYSI RecName: Full=GDT1-like protein 4; Flags... 58 2e-06 gb|EPS68258.1| hypothetical protein M569_06512, partial [Genlise... 58 3e-06 gb|EYU39706.1| hypothetical protein MIMGU_mgv1a011038mg [Mimulus... 57 5e-06 >ref|XP_006840886.1| hypothetical protein AMTR_s00087p00047450 [Amborella trichopoda] gi|548842741|gb|ERN02561.1| hypothetical protein AMTR_s00087p00047450 [Amborella trichopoda] Length = 304 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 LYAFFGLRLLYIAWRSDSKTSQKKEMEEV 87 LYAFFGLRLLYIAWRSDSKTSQKKEMEEV Sbjct: 167 LYAFFGLRLLYIAWRSDSKTSQKKEMEEV 195 >ref|XP_002325903.2| hypothetical protein POPTR_0019s08060g [Populus trichocarpa] gi|550316993|gb|EEF00285.2| hypothetical protein POPTR_0019s08060g [Populus trichocarpa] Length = 235 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +1 Query: 1 LYAFFGLRLLYIAWRSDSKTSQKKEMEEV 87 LYAFFGLRLLYIAWRSDSK+SQKKEMEEV Sbjct: 98 LYAFFGLRLLYIAWRSDSKSSQKKEMEEV 126 >ref|XP_002278837.2| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At3g23330 [Vitis vinifera] Length = 1008 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 1 LYAFFGLRLLYIAWRSDSKTSQKKEMEEV 87 LYAFFGLRLLYIAWRSDSK SQKKEMEEV Sbjct: 154 LYAFFGLRLLYIAWRSDSKASQKKEMEEV 182 >ref|XP_002514857.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223545908|gb|EEF47411.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 832 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 1 LYAFFGLRLLYIAWRSDSKTSQKKEMEEV 87 LYAFFGLRLLYIAWRSDSK SQKKEMEEV Sbjct: 146 LYAFFGLRLLYIAWRSDSKVSQKKEMEEV 174 >emb|CBI17645.3| unnamed protein product [Vitis vinifera] Length = 291 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 1 LYAFFGLRLLYIAWRSDSKTSQKKEMEEV 87 LYAFFGLRLLYIAWRSDSK SQKKEMEEV Sbjct: 154 LYAFFGLRLLYIAWRSDSKASQKKEMEEV 182 >emb|CAN82640.1| hypothetical protein VITISV_028821 [Vitis vinifera] Length = 291 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 1 LYAFFGLRLLYIAWRSDSKTSQKKEMEEV 87 LYAFFGLRLLYIAWRSDSK SQKKEMEEV Sbjct: 154 LYAFFGLRLLYIAWRSDSKASQKKEMEEV 182 >gb|ABK23677.1| unknown [Picea sitchensis] gi|224286876|gb|ACN41141.1| unknown [Picea sitchensis] Length = 302 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +1 Query: 1 LYAFFGLRLLYIAWRSDSKTSQKKEMEEVLRYSQN 105 LYAFFGLRLLYIAWRSD+K SQKKEMEEV +N Sbjct: 165 LYAFFGLRLLYIAWRSDAKNSQKKEMEEVEEKLEN 199 >ref|XP_006660314.1| PREDICTED: GDT1-like protein 4-like [Oryza brachyantha] Length = 291 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 1 LYAFFGLRLLYIAWRSDSKTSQKKEMEEV 87 LYAFFGLRLLYIAWRSDSK SQKKE+EEV Sbjct: 154 LYAFFGLRLLYIAWRSDSKASQKKEIEEV 182 >ref|XP_004973981.1| PREDICTED: GDT1-like protein 4-like [Setaria italica] Length = 285 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 1 LYAFFGLRLLYIAWRSDSKTSQKKEMEEV 87 LYAFFGLRLLYIAWRSDSK SQKKE+EEV Sbjct: 148 LYAFFGLRLLYIAWRSDSKASQKKEIEEV 176 >ref|XP_007029388.1| Uncharacterized protein isoform 2, partial [Theobroma cacao] gi|508717993|gb|EOY09890.1| Uncharacterized protein isoform 2, partial [Theobroma cacao] Length = 231 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 1 LYAFFGLRLLYIAWRSDSKTSQKKEMEEV 87 LYAFFGLRLLYIAWRSDSK SQKKE+EEV Sbjct: 126 LYAFFGLRLLYIAWRSDSKASQKKEIEEV 154 >ref|XP_007029387.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508717992|gb|EOY09889.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 293 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 1 LYAFFGLRLLYIAWRSDSKTSQKKEMEEV 87 LYAFFGLRLLYIAWRSDSK SQKKE+EEV Sbjct: 156 LYAFFGLRLLYIAWRSDSKASQKKEIEEV 184 >ref|NP_001062312.1| Os08g0528500 [Oryza sativa Japonica Group] gi|75136025|sp|Q6ZIB9.1|GDT14_ORYSJ RecName: Full=GDT1-like protein 4; Flags: Precursor gi|42407963|dbj|BAD09101.1| putative transmembrane protein(TPA regulated locus protein) [Oryza sativa Japonica Group] gi|113624281|dbj|BAF24226.1| Os08g0528500 [Oryza sativa Japonica Group] gi|215766897|dbj|BAG99125.1| unnamed protein product [Oryza sativa Japonica Group] Length = 282 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 1 LYAFFGLRLLYIAWRSDSKTSQKKEMEEV 87 LYAFFGLRLLYIAWRSDSK SQKKE+EEV Sbjct: 145 LYAFFGLRLLYIAWRSDSKASQKKEIEEV 173 >tpg|DAA48176.1| TPA: hypothetical protein ZEAMMB73_131539 [Zea mays] Length = 232 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 1 LYAFFGLRLLYIAWRSDSKTSQKKEMEEV 87 LYAFFGLRLLYIAWRSDSK SQKKE+EEV Sbjct: 146 LYAFFGLRLLYIAWRSDSKASQKKEIEEV 174 >ref|XP_003572431.1| PREDICTED: GDT1-like protein 4-like [Brachypodium distachyon] Length = 289 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 1 LYAFFGLRLLYIAWRSDSKTSQKKEMEEV 87 LYAFFGLRLLYIAWRSDSK SQKKE+EEV Sbjct: 152 LYAFFGLRLLYIAWRSDSKASQKKEIEEV 180 >ref|XP_002444709.1| hypothetical protein SORBIDRAFT_07g026430 [Sorghum bicolor] gi|241941059|gb|EES14204.1| hypothetical protein SORBIDRAFT_07g026430 [Sorghum bicolor] Length = 292 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 1 LYAFFGLRLLYIAWRSDSKTSQKKEMEEV 87 LYAFFGLRLLYIAWRSDSK SQKKE+EEV Sbjct: 155 LYAFFGLRLLYIAWRSDSKASQKKEIEEV 183 >ref|NP_001141271.1| hypothetical protein precursor [Zea mays] gi|194703684|gb|ACF85926.1| unknown [Zea mays] gi|414869618|tpg|DAA48175.1| TPA: hypothetical protein ZEAMMB73_131539 [Zea mays] Length = 283 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 1 LYAFFGLRLLYIAWRSDSKTSQKKEMEEV 87 LYAFFGLRLLYIAWRSDSK SQKKE+EEV Sbjct: 146 LYAFFGLRLLYIAWRSDSKASQKKEIEEV 174 >gb|EAZ43426.1| hypothetical protein OsJ_28031 [Oryza sativa Japonica Group] Length = 244 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 1 LYAFFGLRLLYIAWRSDSKTSQKKEMEEV 87 LYAFFGLRLLYIAWRSDSK SQKKE+EEV Sbjct: 107 LYAFFGLRLLYIAWRSDSKASQKKEIEEV 135 >sp|A2YXC7.1|GDT14_ORYSI RecName: Full=GDT1-like protein 4; Flags: Precursor gi|125562290|gb|EAZ07738.1| hypothetical protein OsI_29993 [Oryza sativa Indica Group] Length = 281 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 1 LYAFFGLRLLYIAWRSDSKTSQKKEMEEV 87 LYAFFGLRLLYIAWRSDSK SQKKE+EEV Sbjct: 144 LYAFFGLRLLYIAWRSDSKASQKKEIEEV 172 >gb|EPS68258.1| hypothetical protein M569_06512, partial [Genlisea aurea] Length = 225 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +1 Query: 1 LYAFFGLRLLYIAWRSDSKTSQKKEMEEVLRYSQNTP 111 LYAFFGLRLLYIAWRS+SK+SQKKEM+EV ++ P Sbjct: 88 LYAFFGLRLLYIAWRSNSKSSQKKEMDEVEEKLESMP 124 >gb|EYU39706.1| hypothetical protein MIMGU_mgv1a011038mg [Mimulus guttatus] Length = 294 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 1 LYAFFGLRLLYIAWRSDSKTSQKKEMEEV 87 LYAFFGLRLLYIAW+SDSK SQKKE+EEV Sbjct: 157 LYAFFGLRLLYIAWKSDSKASQKKEIEEV 185