BLASTX nr result
ID: Akebia23_contig00027601
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00027601 (392 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON67949.1| hypothetical protein W97_07446 [Coniosporium apol... 108 6e-22 gb|EKG15940.1| Conidiation-specific protein 6 [Macrophomina phas... 96 4e-18 gb|EOA85438.1| hypothetical protein SETTUDRAFT_90143 [Setosphaer... 74 3e-11 gb|EMC92159.1| hypothetical protein BAUCODRAFT_38184 [Baudoinia ... 73 4e-11 ref|XP_007378919.1| hypothetical protein PUNSTDRAFT_129652 [Punc... 73 5e-11 ref|XP_003709019.1| hypothetical protein MGG_02246 [Magnaporthe ... 73 5e-11 ref|XP_003302011.1| hypothetical protein PTT_13682 [Pyrenophora ... 72 6e-11 ref|XP_001932610.1| hypothetical protein PTRG_02277 [Pyrenophora... 72 1e-10 gb|EOA85035.1| hypothetical protein SETTUDRAFT_89997 [Setosphaer... 70 2e-10 gb|EUC27878.1| hypothetical protein COCCADRAFT_9644 [Bipolaris z... 70 3e-10 gb|EMD94560.1| hypothetical protein COCHEDRAFT_1167532 [Bipolari... 70 4e-10 gb|EMD58522.1| hypothetical protein COCSADRAFT_165347 [Bipolaris... 69 7e-10 gb|EON62167.1| hypothetical protein W97_01387 [Coniosporium apol... 69 9e-10 ref|XP_007584165.1| putative conidiation-specific protein 6 prot... 69 9e-10 ref|XP_003008824.1| conserved hypothetical protein [Verticillium... 68 2e-09 ref|XP_001793630.1| hypothetical protein SNOG_03041 [Phaeosphaer... 68 2e-09 gb|EGY13432.1| hypothetical protein VDAG_00114 [Verticillium dah... 67 3e-09 ref|XP_002839905.1| hypothetical protein [Tuber melanosporum Mel... 67 3e-09 gb|EXA44629.1| hypothetical protein FOVG_06007 [Fusarium oxyspor... 67 3e-09 ref|XP_007378422.1| hypothetical protein PUNSTDRAFT_129184 [Punc... 67 3e-09 >gb|EON67949.1| hypothetical protein W97_07446 [Coniosporium apollinis CBS 100218] Length = 96 Score = 108 bits (271), Expect = 6e-22 Identities = 51/72 (70%), Positives = 59/72 (81%) Frame = -1 Query: 320 DENYHNTPEDISNSAQGHKANLSNPNTSEASKFHSQSVLRQLGDDQAFYGKEEEAKNPNN 141 D+ + +PEDISN AQGHKANLSNPNTSEASK +S+ L LG + AFYGK+EE KNP N Sbjct: 8 DQAINESPEDISNQAQGHKANLSNPNTSEASKENSRQALEDLGGEDAFYGKKEEEKNPGN 67 Query: 140 VAGGLKATVNNP 105 VAGGLKAT+NNP Sbjct: 68 VAGGLKATINNP 79 >gb|EKG15940.1| Conidiation-specific protein 6 [Macrophomina phaseolina MS6] Length = 108 Score = 96.3 bits (238), Expect = 4e-18 Identities = 48/81 (59%), Positives = 61/81 (75%) Frame = -1 Query: 353 RRHFTKSTTMQDENYHNTPEDISNSAQGHKANLSNPNTSEASKFHSQSVLRQLGDDQAFY 174 +R+ + T+Q N + PEDIS+ AQGHKANLSNPNTSE SK +S+ VL LG + AFY Sbjct: 4 QRNIDRDATLQGIN--DQPEDISHQAQGHKANLSNPNTSEESKKNSRQVLESLGGEGAFY 61 Query: 173 GKEEEAKNPNNVAGGLKATVN 111 GKEEE+K+P VA GLK+T+N Sbjct: 62 GKEEESKDPTRVAAGLKSTIN 82 >gb|EOA85438.1| hypothetical protein SETTUDRAFT_90143 [Setosphaeria turcica Et28A] Length = 85 Score = 73.6 bits (179), Expect = 3e-11 Identities = 38/64 (59%), Positives = 47/64 (73%), Gaps = 3/64 (4%) Frame = -1 Query: 284 NSAQGHKANLSNPNTSEASKFHSQSVLRQL---GDDQAFYGKEEEAKNPNNVAGGLKATV 114 N GHKANLSNPNTS+ +K HS+ VL+++ GD Q+ + KNPNNVAGGLKAT+ Sbjct: 7 NIIGGHKANLSNPNTSDEAKQHSKEVLQEIENGGDPQSMTSNSGD-KNPNNVAGGLKATL 65 Query: 113 NNPN 102 NNPN Sbjct: 66 NNPN 69 >gb|EMC92159.1| hypothetical protein BAUCODRAFT_38184 [Baudoinia compniacensis UAMH 10762] Length = 93 Score = 73.2 bits (178), Expect = 4e-11 Identities = 39/72 (54%), Positives = 49/72 (68%), Gaps = 6/72 (8%) Frame = -1 Query: 305 NTPEDISNSAQGHKANLSNPNTSEASKFHSQSVLRQLGDDQAFYGKEEE------AKNPN 144 NT ED ++AQGHKANLSNPNTSE SK +S+ L QLG + AFYGK+ + + N Sbjct: 3 NTAEDRMHAAQGHKANLSNPNTSEESKKNSRQALEQLGGEDAFYGKKGDDAPAAGMGDDN 62 Query: 143 NVAGGLKATVNN 108 V GG KAT++N Sbjct: 63 RVLGGHKATLSN 74 >ref|XP_007378919.1| hypothetical protein PUNSTDRAFT_129652 [Punctularia strigosozonata HHB-11173 SS5] gi|390604611|gb|EIN14002.1| hypothetical protein PUNSTDRAFT_129652 [Punctularia strigosozonata HHB-11173 SS5] Length = 96 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/59 (57%), Positives = 45/59 (76%) Frame = -1 Query: 278 AQGHKANLSNPNTSEASKFHSQSVLRQLGDDQAFYGKEEEAKNPNNVAGGLKATVNNPN 102 A GHKAN++NPNTS+ SK HS+ L ++ ++ F + + AKNPNNVAGG KAT+NNPN Sbjct: 4 AGGHKANINNPNTSDQSKEHSRQALSEI-EESGFLDQPKHAKNPNNVAGGHKATLNNPN 61 >ref|XP_003709019.1| hypothetical protein MGG_02246 [Magnaporthe oryzae 70-15] gi|351648548|gb|EHA56407.1| hypothetical protein MGG_02246 [Magnaporthe oryzae 70-15] gi|440474463|gb|ELQ43202.1| hypothetical protein OOU_Y34scaffold00164g12 [Magnaporthe oryzae Y34] gi|440481054|gb|ELQ61679.1| hypothetical protein OOW_P131scaffold01164g11 [Magnaporthe oryzae P131] Length = 85 Score = 72.8 bits (177), Expect = 5e-11 Identities = 37/61 (60%), Positives = 42/61 (68%), Gaps = 2/61 (3%) Frame = -1 Query: 278 AQGHKANLSNPNTSEASKFHSQSVLRQL--GDDQAFYGKEEEAKNPNNVAGGLKATVNNP 105 A GHKANL NPNTSE SK HS+ VL + G D G+ +E KNP NVAGGLKA + NP Sbjct: 7 AGGHKANLKNPNTSEESKQHSKKVLEEQFDGGDVPKAGESDEGKNPGNVAGGLKAAIKNP 66 Query: 104 N 102 N Sbjct: 67 N 67 >ref|XP_003302011.1| hypothetical protein PTT_13682 [Pyrenophora teres f. teres 0-1] gi|311322844|gb|EFQ89877.1| hypothetical protein PTT_13682 [Pyrenophora teres f. teres 0-1] Length = 75 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/52 (65%), Positives = 40/52 (76%) Frame = -1 Query: 320 DENYHNTPEDISNSAQGHKANLSNPNTSEASKFHSQSVLRQLGDDQAFYGKE 165 D+N +NT EDISN A+GHKANLSNPNTSE SK S L+ LG + AFYGK+ Sbjct: 20 DQNINNTVEDISNQARGHKANLSNPNTSEESKKKSAEALKALGGEDAFYGKQ 71 >ref|XP_001932610.1| hypothetical protein PTRG_02277 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187974216|gb|EDU41715.1| hypothetical protein PTRG_02277 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 75 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/52 (65%), Positives = 39/52 (75%) Frame = -1 Query: 320 DENYHNTPEDISNSAQGHKANLSNPNTSEASKFHSQSVLRQLGDDQAFYGKE 165 D+N +NT EDISN A+GHKANLSNPNTSE SK S L LG + AFYGK+ Sbjct: 20 DQNINNTVEDISNQARGHKANLSNPNTSEESKKKSAEALEALGGEDAFYGKQ 71 >gb|EOA85035.1| hypothetical protein SETTUDRAFT_89997 [Setosphaeria turcica Et28A] Length = 73 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/52 (63%), Positives = 40/52 (76%) Frame = -1 Query: 320 DENYHNTPEDISNSAQGHKANLSNPNTSEASKFHSQSVLRQLGDDQAFYGKE 165 D+N +NT EDIS+ A GHKANLSNPNTSE SK +S L+ LG + AFYGK+ Sbjct: 18 DQNINNTVEDISHQAAGHKANLSNPNTSEQSKKNSAEALKALGGEDAFYGKQ 69 >gb|EUC27878.1| hypothetical protein COCCADRAFT_9644 [Bipolaris zeicola 26-R-13] gi|576930827|gb|EUC44400.1| hypothetical protein COCMIDRAFT_98293 [Bipolaris oryzae ATCC 44560] gi|578484708|gb|EUN22224.1| hypothetical protein COCVIDRAFT_30731 [Bipolaris victoriae FI3] Length = 85 Score = 70.1 bits (170), Expect = 3e-10 Identities = 35/63 (55%), Positives = 44/63 (69%), Gaps = 2/63 (3%) Frame = -1 Query: 284 NSAQGHKANLSNPNTSEASKFHSQSVLRQL--GDDQAFYGKEEEAKNPNNVAGGLKATVN 111 N GHKAN++NPNTSE +K HS+ VL+ L G + ++ KNPNNVAGGLKAT+ Sbjct: 7 NVIGGHKANINNPNTSEEAKQHSKEVLQDLENGGEITSKSTSDQDKNPNNVAGGLKATLK 66 Query: 110 NPN 102 NPN Sbjct: 67 NPN 69 >gb|EMD94560.1| hypothetical protein COCHEDRAFT_1167532 [Bipolaris maydis C5] gi|477582538|gb|ENH99645.1| hypothetical protein COCC4DRAFT_152717 [Bipolaris maydis ATCC 48331] Length = 85 Score = 69.7 bits (169), Expect = 4e-10 Identities = 35/63 (55%), Positives = 43/63 (68%), Gaps = 2/63 (3%) Frame = -1 Query: 284 NSAQGHKANLSNPNTSEASKFHSQSVLRQL--GDDQAFYGKEEEAKNPNNVAGGLKATVN 111 N GHKAN++NPNTS+ +K HS+ VL L G + +E KNPNNVAGGLKAT+ Sbjct: 7 NVIGGHKANINNPNTSDEAKQHSKEVLENLENGGEITSKSTSDEDKNPNNVAGGLKATLK 66 Query: 110 NPN 102 NPN Sbjct: 67 NPN 69 >gb|EMD58522.1| hypothetical protein COCSADRAFT_165347 [Bipolaris sorokiniana ND90Pr] Length = 85 Score = 68.9 bits (167), Expect = 7e-10 Identities = 34/63 (53%), Positives = 44/63 (69%), Gaps = 2/63 (3%) Frame = -1 Query: 284 NSAQGHKANLSNPNTSEASKFHSQSVLRQL--GDDQAFYGKEEEAKNPNNVAGGLKATVN 111 N GHKAN++NPNTS+ +K HS+ VL+ L G + ++ KNPNNVAGGLKAT+ Sbjct: 7 NVIGGHKANINNPNTSDEAKQHSKEVLQDLENGGEITSKSTSDQDKNPNNVAGGLKATLK 66 Query: 110 NPN 102 NPN Sbjct: 67 NPN 69 >gb|EON62167.1| hypothetical protein W97_01387 [Coniosporium apollinis CBS 100218] Length = 88 Score = 68.6 bits (166), Expect = 9e-10 Identities = 36/67 (53%), Positives = 43/67 (64%), Gaps = 6/67 (8%) Frame = -1 Query: 284 NSAQGHKANLSNPNTSEASKFHSQSVLRQ------LGDDQAFYGKEEEAKNPNNVAGGLK 123 N GHKANL+NPNTSE SK HS+ VL Q + + E +NPNNVAGGLK Sbjct: 6 NVIGGHKANLNNPNTSEESKQHSKEVLEQASNSGEIDTSSSSSSGSTEGQNPNNVAGGLK 65 Query: 122 ATVNNPN 102 AT++NPN Sbjct: 66 ATLSNPN 72 >ref|XP_007584165.1| putative conidiation-specific protein 6 protein [Neofusicoccum parvum UCRNP2] gi|485923122|gb|EOD48357.1| putative conidiation-specific protein 6 protein [Neofusicoccum parvum UCRNP2] Length = 81 Score = 68.6 bits (166), Expect = 9e-10 Identities = 37/65 (56%), Positives = 45/65 (69%), Gaps = 4/65 (6%) Frame = -1 Query: 284 NSAQGHKANLSNPNTSEASKFHSQSVLRQLGDDQAFYG----KEEEAKNPNNVAGGLKAT 117 N GHKANL+NPNTS+ +K HS+ VL DQ F G + ++ KNP NVAGGLKAT Sbjct: 6 NIIGGHKANLNNPNTSDEAKQHSKEVL-----DQEFDGGNIPQADQNKNPGNVAGGLKAT 60 Query: 116 VNNPN 102 +NNPN Sbjct: 61 LNNPN 65 >ref|XP_003008824.1| conserved hypothetical protein [Verticillium alfalfae VaMs.102] gi|261351970|gb|EEY14398.1| conserved hypothetical protein [Verticillium alfalfae VaMs.102] Length = 88 Score = 67.8 bits (164), Expect = 2e-09 Identities = 36/65 (55%), Positives = 44/65 (67%), Gaps = 6/65 (9%) Frame = -1 Query: 278 AQGHKANLSNPNTSEASKFHSQSVL-RQLGDDQA-----FYGKEEEAKNPNNVAGGLKAT 117 A GHKAN++NPNTSE SK HS+ VL + G + A ++ KNP NVAGGLKAT Sbjct: 8 AGGHKANINNPNTSEESKQHSRDVLNNEFGGEDAPNAASAQSANDDNKNPGNVAGGLKAT 67 Query: 116 VNNPN 102 +NNPN Sbjct: 68 LNNPN 72 >ref|XP_001793630.1| hypothetical protein SNOG_03041 [Phaeosphaeria nodorum SN15] gi|111068652|gb|EAT89772.1| hypothetical protein SNOG_03041 [Phaeosphaeria nodorum SN15] Length = 76 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/52 (59%), Positives = 40/52 (76%) Frame = -1 Query: 320 DENYHNTPEDISNSAQGHKANLSNPNTSEASKFHSQSVLRQLGDDQAFYGKE 165 D+N +N+ ED S+ A GHKANLSNPNTS SK S+ L++LG +QAFYGK+ Sbjct: 21 DQNINNSVEDKSHQAAGHKANLSNPNTSAESKKRSEQALKELGGEQAFYGKQ 72 >gb|EGY13432.1| hypothetical protein VDAG_00114 [Verticillium dahliae VdLs.17] Length = 88 Score = 67.0 bits (162), Expect = 3e-09 Identities = 36/65 (55%), Positives = 43/65 (66%), Gaps = 6/65 (9%) Frame = -1 Query: 278 AQGHKANLSNPNTSEASKFHSQSVL-RQLGDDQA-----FYGKEEEAKNPNNVAGGLKAT 117 A GHKAN++NPNTSE SK HS+ VL G + A ++ KNP NVAGGLKAT Sbjct: 8 AGGHKANINNPNTSEESKQHSRDVLNNDFGGEDAPNAASAQSANDDNKNPGNVAGGLKAT 67 Query: 116 VNNPN 102 +NNPN Sbjct: 68 LNNPN 72 >ref|XP_002839905.1| hypothetical protein [Tuber melanosporum Mel28] gi|295636112|emb|CAZ84096.1| unnamed protein product [Tuber melanosporum] Length = 98 Score = 67.0 bits (162), Expect = 3e-09 Identities = 35/72 (48%), Positives = 44/72 (61%), Gaps = 7/72 (9%) Frame = -1 Query: 296 EDISNSAQGHKANLSNPNTSEASKFHSQSVLRQLGDDQAFYGK-------EEEAKNPNNV 138 +++ N GHKANL NPNTS +K HS+ VL +LG + Y E KNP NV Sbjct: 8 KNLGNVIGGHKANLHNPNTSPEAKQHSREVLEELGFETTSYTSGPSGVDVNIEGKNPGNV 67 Query: 137 AGGLKATVNNPN 102 AGG KAT++NPN Sbjct: 68 AGGYKATLHNPN 79 >gb|EXA44629.1| hypothetical protein FOVG_06007 [Fusarium oxysporum f. sp. pisi HDV247] gi|590063055|gb|EXK90579.1| hypothetical protein FOQG_06812 [Fusarium oxysporum f. sp. raphani 54005] gi|591503688|gb|EXM33033.1| hypothetical protein FOTG_03154 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 84 Score = 66.6 bits (161), Expect = 3e-09 Identities = 34/63 (53%), Positives = 43/63 (68%), Gaps = 1/63 (1%) Frame = -1 Query: 287 SNSAQGHKANLSNPNTSEASKFHSQSVLRQLGDDQAFYGKEEEA-KNPNNVAGGLKATVN 111 + +A GHKA ++NPNTSE +K HS+ VL + G E+ KNP NVAGGLKAT+N Sbjct: 4 AQAAGGHKATINNPNTSEEAKEHSRQVLENEFNGGEVTGAEDNKDKNPGNVAGGLKATLN 63 Query: 110 NPN 102 NPN Sbjct: 64 NPN 66 >ref|XP_007378422.1| hypothetical protein PUNSTDRAFT_129184 [Punctularia strigosozonata HHB-11173 SS5] gi|390604114|gb|EIN13505.1| hypothetical protein PUNSTDRAFT_129184 [Punctularia strigosozonata HHB-11173 SS5] Length = 76 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/58 (55%), Positives = 42/58 (72%) Frame = -1 Query: 284 NSAQGHKANLSNPNTSEASKFHSQSVLRQLGDDQAFYGKEEEAKNPNNVAGGLKATVN 111 N A GHKAN++NPNTSE SK HS+ VL ++ ++ + + KNPNNVAGG KAT+N Sbjct: 6 NVAGGHKANINNPNTSEESKEHSRQVLSEI-EESGILDQPKHGKNPNNVAGGHKATIN 62