BLASTX nr result
ID: Akebia23_contig00026327
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00026327 (483 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007213836.1| hypothetical protein PRUPE_ppa010547mg [Prun... 59 9e-07 >ref|XP_007213836.1| hypothetical protein PRUPE_ppa010547mg [Prunus persica] gi|462409701|gb|EMJ15035.1| hypothetical protein PRUPE_ppa010547mg [Prunus persica] Length = 245 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/47 (61%), Positives = 33/47 (70%), Gaps = 5/47 (10%) Frame = -3 Query: 481 VEEHEEFYDENEVIYQSY-----DYLDEVYFSSSSSLRIGNRRWGDN 356 VEE E+ YD+ + Y Y D LDE YFSSSSS+RIGNRRWGDN Sbjct: 129 VEEREDVYDDPDDYYYPYEDEEDDDLDEAYFSSSSSIRIGNRRWGDN 175