BLASTX nr result
ID: Akebia23_contig00026264
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00026264 (298 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002298550.2| hypothetical protein POPTR_0001s35490g [Popu... 60 4e-07 ref|XP_002272446.1| PREDICTED: NAC domain-containing protein 8 [... 60 4e-07 gb|AHJ79160.1| NAC domain protein NAC19 [Gossypium hirsutum] 58 2e-06 ref|XP_004156732.1| PREDICTED: NAC domain-containing protein 8-l... 58 2e-06 ref|XP_004142846.1| PREDICTED: NAC domain-containing protein 8-l... 58 2e-06 ref|XP_004231842.1| PREDICTED: NAC domain-containing protein 8-l... 57 2e-06 ref|XP_007031605.1| NAC domain transcriptional regulator superfa... 57 3e-06 ref|XP_006852355.1| hypothetical protein AMTR_s00049p00217900 [A... 57 4e-06 >ref|XP_002298550.2| hypothetical protein POPTR_0001s35490g [Populus trichocarpa] gi|550348950|gb|EEE83355.2| hypothetical protein POPTR_0001s35490g [Populus trichocarpa] Length = 395 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -2 Query: 294 SDLGNLELETPPDFDLADLQFGSQESITSWLDRL 193 ++L NLEL+TPPDF LADLQFGSQESI WLDRL Sbjct: 362 AELENLELDTPPDFQLADLQFGSQESILGWLDRL 395 >ref|XP_002272446.1| PREDICTED: NAC domain-containing protein 8 [Vitis vinifera] gi|296087593|emb|CBI34849.3| unnamed protein product [Vitis vinifera] Length = 398 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -2 Query: 294 SDLGNLELETPPDFDLADLQFGSQESITSWLDRL 193 +DL NLEL+TPPDF LADLQFGSQ+SI WLDRL Sbjct: 365 ADLENLELDTPPDFQLADLQFGSQDSIFGWLDRL 398 >gb|AHJ79160.1| NAC domain protein NAC19 [Gossypium hirsutum] Length = 398 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -2 Query: 294 SDLGNLELETPPDFDLADLQFGSQESITSWLDRL 193 S+L NLE +TPPD LADLQFGSQESI SWLDRL Sbjct: 365 SELENLEFDTPPDVTLADLQFGSQESILSWLDRL 398 >ref|XP_004156732.1| PREDICTED: NAC domain-containing protein 8-like [Cucumis sativus] Length = 518 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -2 Query: 294 SDLGNLELETPPDFDLADLQFGSQESITSWLDRL 193 +DL NL+L+TPPDF LADLQFGSQESI W+DR+ Sbjct: 485 ADLENLDLDTPPDFHLADLQFGSQESIFDWIDRI 518 >ref|XP_004142846.1| PREDICTED: NAC domain-containing protein 8-like [Cucumis sativus] Length = 518 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -2 Query: 294 SDLGNLELETPPDFDLADLQFGSQESITSWLDRL 193 +DL NL+L+TPPDF LADLQFGSQESI W+DR+ Sbjct: 485 ADLENLDLDTPPDFHLADLQFGSQESIFDWIDRI 518 >ref|XP_004231842.1| PREDICTED: NAC domain-containing protein 8-like [Solanum lycopersicum] Length = 393 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -2 Query: 294 SDLGNLELETPPDFDLADLQFGSQESITSWLDRL 193 S+L NLEL++PPDF LADL FGSQE+I SWLDRL Sbjct: 360 SELDNLELDSPPDFQLADLPFGSQENIFSWLDRL 393 >ref|XP_007031605.1| NAC domain transcriptional regulator superfamily protein, putative [Theobroma cacao] gi|508710634|gb|EOY02531.1| NAC domain transcriptional regulator superfamily protein, putative [Theobroma cacao] Length = 392 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 294 SDLGNLELETPPDFDLADLQFGSQESITSWLDRL 193 S+L NL+ +TPPD LADLQFGSQESI SWLDRL Sbjct: 359 SELENLDFDTPPDLPLADLQFGSQESILSWLDRL 392 >ref|XP_006852355.1| hypothetical protein AMTR_s00049p00217900 [Amborella trichopoda] gi|548855959|gb|ERN13822.1| hypothetical protein AMTR_s00049p00217900 [Amborella trichopoda] Length = 141 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -2 Query: 294 SDLGNLELETPPDFDLADLQFGSQESITSWLDRL*RD 184 S+L N+EL+TPPD L DLQFGSQES+ WLDRL D Sbjct: 103 SELENIELDTPPDIQLGDLQFGSQESVMGWLDRLFND 139