BLASTX nr result
ID: Akebia23_contig00026135
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00026135 (347 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270101.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid ox... 60 4e-07 emb|CAN60339.1| hypothetical protein VITISV_031318 [Vitis vinifera] 60 4e-07 ref|XP_002529188.1| (S)-2-hydroxy-acid oxidase, putative [Ricinu... 59 9e-07 ref|XP_006426743.1| hypothetical protein CICLE_v10025922mg [Citr... 58 2e-06 ref|XP_006426742.1| hypothetical protein CICLE_v10025922mg [Citr... 58 2e-06 ref|XP_006426722.1| hypothetical protein CICLE_v10025921mg [Citr... 58 2e-06 ref|XP_002529194.1| (S)-2-hydroxy-acid oxidase, putative [Ricinu... 58 2e-06 ref|XP_007024701.1| Aldolase-type TIM barrel family protein isof... 57 2e-06 ref|XP_004303716.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid ox... 57 3e-06 sp|Q01KC2.2|GLO2_ORYSI RecName: Full=Peroxisomal (S)-2-hydroxy-a... 57 3e-06 gb|EEE61717.1| hypothetical protein OsJ_16218 [Oryza sativa Japo... 57 3e-06 gb|EEC78044.1| hypothetical protein OsI_17480 [Oryza sativa Indi... 57 3e-06 emb|CAH66797.1| H0215F08.8 [Oryza sativa Indica Group] 57 3e-06 emb|CAE03501.2| OSJNBa0053K19.9 [Oryza sativa Japonica Group] 57 3e-06 ref|XP_006426731.1| hypothetical protein CICLE_v10025729mg [Citr... 56 4e-06 ref|XP_006426728.1| hypothetical protein CICLE_v10025729mg [Citr... 56 4e-06 ref|XP_006426726.1| hypothetical protein CICLE_v10025729mg [Citr... 56 4e-06 ref|XP_002529193.1| (S)-2-hydroxy-acid oxidase, putative [Ricinu... 56 4e-06 ref|XP_006466140.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid ox... 56 6e-06 ref|XP_002304232.2| (S)-2-hydroxy-acid oxidase family protein [P... 56 6e-06 >ref|XP_002270101.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO4 [Vitis vinifera] gi|297742968|emb|CBI35835.3| unnamed protein product [Vitis vinifera] Length = 364 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +1 Query: 1 AQLVQRAERNGYKAIVLTADTPWFGRREASIKNK 102 AQLVQRAERNG+KAIVLTADTP GRREA IKN+ Sbjct: 140 AQLVQRAERNGFKAIVLTADTPRLGRREADIKNR 173 >emb|CAN60339.1| hypothetical protein VITISV_031318 [Vitis vinifera] Length = 364 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +1 Query: 1 AQLVQRAERNGYKAIVLTADTPWFGRREASIKNK 102 AQLVQRAERNG+KAIVLTADTP GRREA IKN+ Sbjct: 140 AQLVQRAERNGFKAIVLTADTPRLGRREADIKNR 173 >ref|XP_002529188.1| (S)-2-hydroxy-acid oxidase, putative [Ricinus communis] gi|223531366|gb|EEF33202.1| (S)-2-hydroxy-acid oxidase, putative [Ricinus communis] Length = 364 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 1 AQLVQRAERNGYKAIVLTADTPWFGRREASIKNK 102 A+LVQRAERNGYKAIVLTAD P GRREA IKNK Sbjct: 140 AKLVQRAERNGYKAIVLTADCPRLGRREADIKNK 173 >ref|XP_006426743.1| hypothetical protein CICLE_v10025922mg [Citrus clementina] gi|557528733|gb|ESR39983.1| hypothetical protein CICLE_v10025922mg [Citrus clementina] Length = 364 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +1 Query: 1 AQLVQRAERNGYKAIVLTADTPWFGRREASIKNK 102 A LVQRAERNG+KA+VLTADTP GRREA IKNK Sbjct: 140 ATLVQRAERNGFKALVLTADTPRLGRREADIKNK 173 >ref|XP_006426742.1| hypothetical protein CICLE_v10025922mg [Citrus clementina] gi|557528732|gb|ESR39982.1| hypothetical protein CICLE_v10025922mg [Citrus clementina] Length = 350 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +1 Query: 1 AQLVQRAERNGYKAIVLTADTPWFGRREASIKNK 102 A LVQRAERNG+KA+VLTADTP GRREA IKNK Sbjct: 126 ATLVQRAERNGFKALVLTADTPRLGRREADIKNK 159 >ref|XP_006426722.1| hypothetical protein CICLE_v10025921mg [Citrus clementina] gi|567868201|ref|XP_006426723.1| hypothetical protein CICLE_v10025921mg [Citrus clementina] gi|557528712|gb|ESR39962.1| hypothetical protein CICLE_v10025921mg [Citrus clementina] gi|557528713|gb|ESR39963.1| hypothetical protein CICLE_v10025921mg [Citrus clementina] Length = 364 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +1 Query: 1 AQLVQRAERNGYKAIVLTADTPWFGRREASIKNK 102 A LVQRAERNG+KA+VLTADTP GRREA IKNK Sbjct: 140 ATLVQRAERNGFKALVLTADTPRLGRREADIKNK 173 >ref|XP_002529194.1| (S)-2-hydroxy-acid oxidase, putative [Ricinus communis] gi|223531372|gb|EEF33208.1| (S)-2-hydroxy-acid oxidase, putative [Ricinus communis] Length = 364 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +1 Query: 1 AQLVQRAERNGYKAIVLTADTPWFGRREASIKNK 102 AQLVQRAERNGYKAIVLT D P GRREA I+NK Sbjct: 140 AQLVQRAERNGYKAIVLTVDAPRLGRREADIRNK 173 >ref|XP_007024701.1| Aldolase-type TIM barrel family protein isoform 1 [Theobroma cacao] gi|508780067|gb|EOY27323.1| Aldolase-type TIM barrel family protein isoform 1 [Theobroma cacao] Length = 364 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +1 Query: 1 AQLVQRAERNGYKAIVLTADTPWFGRREASIKNK 102 A+LVQRAE NGYKAIVLTAD+P GRREA IKNK Sbjct: 140 AKLVQRAENNGYKAIVLTADSPRLGRREADIKNK 173 >ref|XP_004303716.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO4-like [Fragaria vesca subsp. vesca] Length = 365 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 1 AQLVQRAERNGYKAIVLTADTPWFGRREASIKNK 102 AQ+VQRAE+NGYKAIVLT D P GRREA IKNK Sbjct: 140 AQIVQRAEKNGYKAIVLTVDVPRLGRREADIKNK 173 >sp|Q01KC2.2|GLO2_ORYSI RecName: Full=Peroxisomal (S)-2-hydroxy-acid oxidase GLO2; AltName: Full=Glycolate oxidase 2; Short=GOX 2; Short=OsGLO2; AltName: Full=Short chain alpha-hydroxy acid oxidase GLO2 gi|317376216|sp|Q7XPR4.3|GLO2_ORYSJ RecName: Full=Peroxisomal (S)-2-hydroxy-acid oxidase GLO2; AltName: Full=Glycolate oxidase 2; Short=GOX 2; Short=OsGLO2; AltName: Full=Short chain alpha-hydroxy acid oxidase GLO2 Length = 368 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +1 Query: 4 QLVQRAERNGYKAIVLTADTPWFGRREASIKNK 102 QL+QRAE+ GYKAIVLT D PW GRREA +KN+ Sbjct: 140 QLIQRAEKAGYKAIVLTVDAPWLGRREADVKNR 172 >gb|EEE61717.1| hypothetical protein OsJ_16218 [Oryza sativa Japonica Group] Length = 315 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +1 Query: 4 QLVQRAERNGYKAIVLTADTPWFGRREASIKNK 102 QL+QRAE+ GYKAIVLT D PW GRREA +KN+ Sbjct: 114 QLIQRAEKAGYKAIVLTVDAPWLGRREADVKNR 146 >gb|EEC78044.1| hypothetical protein OsI_17480 [Oryza sativa Indica Group] Length = 285 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +1 Query: 4 QLVQRAERNGYKAIVLTADTPWFGRREASIKNK 102 QL+QRAE+ GYKAIVLT D PW GRREA +KN+ Sbjct: 114 QLIQRAEKAGYKAIVLTVDAPWLGRREADVKNR 146 >emb|CAH66797.1| H0215F08.8 [Oryza sativa Indica Group] Length = 276 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +1 Query: 4 QLVQRAERNGYKAIVLTADTPWFGRREASIKNK 102 QL+QRAE+ GYKAIVLT D PW GRREA +KN+ Sbjct: 140 QLIQRAEKAGYKAIVLTVDAPWLGRREADVKNR 172 >emb|CAE03501.2| OSJNBa0053K19.9 [Oryza sativa Japonica Group] Length = 276 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +1 Query: 4 QLVQRAERNGYKAIVLTADTPWFGRREASIKNK 102 QL+QRAE+ GYKAIVLT D PW GRREA +KN+ Sbjct: 140 QLIQRAEKAGYKAIVLTVDAPWLGRREADVKNR 172 >ref|XP_006426731.1| hypothetical protein CICLE_v10025729mg [Citrus clementina] gi|557528721|gb|ESR39971.1| hypothetical protein CICLE_v10025729mg [Citrus clementina] Length = 411 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 1 AQLVQRAERNGYKAIVLTADTPWFGRREASIKNK 102 A LVQRAERNG+KA+VLT DTP GRREA IKNK Sbjct: 187 ATLVQRAERNGFKALVLTVDTPRLGRREADIKNK 220 >ref|XP_006426728.1| hypothetical protein CICLE_v10025729mg [Citrus clementina] gi|557528718|gb|ESR39968.1| hypothetical protein CICLE_v10025729mg [Citrus clementina] Length = 350 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 1 AQLVQRAERNGYKAIVLTADTPWFGRREASIKNK 102 A LVQRAERNG+KA+VLT DTP GRREA IKNK Sbjct: 126 ATLVQRAERNGFKALVLTVDTPRLGRREADIKNK 159 >ref|XP_006426726.1| hypothetical protein CICLE_v10025729mg [Citrus clementina] gi|567868209|ref|XP_006426727.1| hypothetical protein CICLE_v10025729mg [Citrus clementina] gi|567868213|ref|XP_006426729.1| hypothetical protein CICLE_v10025729mg [Citrus clementina] gi|567868215|ref|XP_006426730.1| hypothetical protein CICLE_v10025729mg [Citrus clementina] gi|557528716|gb|ESR39966.1| hypothetical protein CICLE_v10025729mg [Citrus clementina] gi|557528717|gb|ESR39967.1| hypothetical protein CICLE_v10025729mg [Citrus clementina] gi|557528719|gb|ESR39969.1| hypothetical protein CICLE_v10025729mg [Citrus clementina] gi|557528720|gb|ESR39970.1| hypothetical protein CICLE_v10025729mg [Citrus clementina] Length = 364 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 1 AQLVQRAERNGYKAIVLTADTPWFGRREASIKNK 102 A LVQRAERNG+KA+VLT DTP GRREA IKNK Sbjct: 140 ATLVQRAERNGFKALVLTVDTPRLGRREADIKNK 173 >ref|XP_002529193.1| (S)-2-hydroxy-acid oxidase, putative [Ricinus communis] gi|223531371|gb|EEF33207.1| (S)-2-hydroxy-acid oxidase, putative [Ricinus communis] Length = 364 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 7 LVQRAERNGYKAIVLTADTPWFGRREASIKNK 102 LVQRAE NGYKAI+LTAD+P FGRREA IKNK Sbjct: 142 LVQRAECNGYKAIILTADSPRFGRREADIKNK 173 >ref|XP_006466140.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO4-like [Citrus sinensis] Length = 248 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 1 AQLVQRAERNGYKAIVLTADTPWFGRREASIKNK 102 A LVQRAERNG+KA+VLTAD P GRREA IKNK Sbjct: 24 ATLVQRAERNGFKALVLTADAPRLGRREADIKNK 57 >ref|XP_002304232.2| (S)-2-hydroxy-acid oxidase family protein [Populus trichocarpa] gi|550342573|gb|EEE79211.2| (S)-2-hydroxy-acid oxidase family protein [Populus trichocarpa] Length = 364 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 7 LVQRAERNGYKAIVLTADTPWFGRREASIKNK 102 LVQRAE++GYKAIVLTADTP GRREA IKNK Sbjct: 142 LVQRAEKSGYKAIVLTADTPRLGRREADIKNK 173