BLASTX nr result
ID: Akebia23_contig00026011
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00026011 (274 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006353602.1| PREDICTED: putative ribonuclease H protein A... 45 8e-06 >ref|XP_006353602.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Solanum tuberosum] Length = 517 Score = 45.4 bits (106), Expect(2) = 8e-06 Identities = 19/45 (42%), Positives = 25/45 (55%) Frame = -2 Query: 147 WAMLPSAIAWGVWNERNNRVFNSKMRSSHGGFLEILGFLYLWSKQ 13 W ++PS I W VW ERNNR F+++ S H + L W KQ Sbjct: 457 WRLIPSCIWWSVWKERNNRCFDNRSNSIHKVKWNCIVSLLFWCKQ 501 Score = 29.6 bits (65), Expect(2) = 8e-06 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = -1 Query: 274 FSYNIWSTFLGLFRIHWVLPCKFSSLLVEW 185 ++ IW+ FL + ++W +P + S++L W Sbjct: 415 YTAQIWNLFLSISNLNWTMPERTSNVLKSW 444