BLASTX nr result
ID: Akebia23_contig00025712
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00025712 (510 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI29919.3| unnamed protein product [Vitis vinifera] 75 9e-12 ref|XP_002282457.1| PREDICTED: thioredoxin-like 1-1, chloroplast... 75 9e-12 emb|CAN64807.1| hypothetical protein VITISV_007145 [Vitis vinifera] 75 9e-12 gb|EXB36260.1| Thioredoxin-like 1-1 [Morus notabilis] 71 2e-10 gb|AAA33400.1| thioredoxin [Lilium longiflorum] 66 6e-09 ref|XP_007161960.1| hypothetical protein PHAVU_001G112200g [Phas... 59 7e-07 ref|XP_006658147.1| PREDICTED: thioredoxin-like 1-1, chloroplast... 58 1e-06 gb|AFD98846.1| chloroplast Trx [Gossypium hirsutum] 57 3e-06 gb|ACN36361.1| unknown [Zea mays] gi|413955845|gb|AFW88494.1| pu... 57 3e-06 ref|NP_001132524.1| putative thioredoxin superfamily protein [Ze... 57 3e-06 ref|XP_007030215.1| Atypical CYS HIS rich thioredoxin 4 [Theobro... 56 5e-06 ref|XP_003624602.1| Thioredoxin-like protein [Medicago truncatul... 56 5e-06 ref|XP_003624601.1| Thioredoxin-like protein [Medicago truncatul... 56 5e-06 ref|XP_006348023.1| PREDICTED: thioredoxin-like 1-1, chloroplast... 56 6e-06 dbj|BAK03063.1| predicted protein [Hordeum vulgare subsp. vulgare] 56 6e-06 gb|EMT24637.1| Thioredoxin-like protein 1 [Aegilops tauschii] 55 8e-06 >emb|CBI29919.3| unnamed protein product [Vitis vinifera] Length = 309 Score = 75.1 bits (183), Expect = 9e-12 Identities = 32/58 (55%), Positives = 43/58 (74%) Frame = +3 Query: 336 NCDFNGTRIILQQVERKPRRKNLQSLPIKMSLCVGKSHKWWEKGLQSNMKDITSAQDL 509 N DF+G RI+LQ++ P+R+N Q+ M L +GK+ KWWEKGLQ NMK++T AQDL Sbjct: 64 NSDFHGGRIVLQEIGSMPKRRNAQASCTLMGLAIGKAQKWWEKGLQPNMKEVTGAQDL 121 >ref|XP_002282457.1| PREDICTED: thioredoxin-like 1-1, chloroplastic-like [Vitis vinifera] Length = 311 Score = 75.1 bits (183), Expect = 9e-12 Identities = 32/58 (55%), Positives = 43/58 (74%) Frame = +3 Query: 336 NCDFNGTRIILQQVERKPRRKNLQSLPIKMSLCVGKSHKWWEKGLQSNMKDITSAQDL 509 N DF+G RI+LQ++ P+R+N Q+ M L +GK+ KWWEKGLQ NMK++T AQDL Sbjct: 66 NSDFHGGRIVLQEIGSMPKRRNAQASCTLMGLAIGKAQKWWEKGLQPNMKEVTGAQDL 123 >emb|CAN64807.1| hypothetical protein VITISV_007145 [Vitis vinifera] Length = 311 Score = 75.1 bits (183), Expect = 9e-12 Identities = 32/58 (55%), Positives = 43/58 (74%) Frame = +3 Query: 336 NCDFNGTRIILQQVERKPRRKNLQSLPIKMSLCVGKSHKWWEKGLQSNMKDITSAQDL 509 N DF+G RI+LQ++ P+R+N Q+ M L +GK+ KWWEKGLQ NMK++T AQDL Sbjct: 66 NSDFHGGRIVLQEIGSMPKRRNAQASCTLMGLAIGKAQKWWEKGLQPNMKEVTGAQDL 123 >gb|EXB36260.1| Thioredoxin-like 1-1 [Morus notabilis] Length = 289 Score = 70.9 bits (172), Expect = 2e-10 Identities = 41/107 (38%), Positives = 57/107 (53%), Gaps = 7/107 (6%) Frame = +3 Query: 210 MAEILSKSNFLSS-----SPCPPHCFFIXXXXXXXXXXXXXXXXXXX--NCDFNGTRIIL 368 MA++LSK++ SS S P C FI N DF+G RI+L Sbjct: 1 MADVLSKTSLFSSINQSISVFPKSCNFIKSGPCCSLKLKSNPSTTSFSSNSDFHGKRIVL 60 Query: 369 QQVERKPRRKNLQSLPIKMSLCVGKSHKWWEKGLQSNMKDITSAQDL 509 Q+ R+ ++ + +L +GK+HKWW KGLQ NMK++TSAQDL Sbjct: 61 QREPRRTSPSQASTINAQTALRIGKAHKWWGKGLQPNMKEVTSAQDL 107 >gb|AAA33400.1| thioredoxin [Lilium longiflorum] Length = 262 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/56 (50%), Positives = 43/56 (76%) Frame = +3 Query: 342 DFNGTRIILQQVERKPRRKNLQSLPIKMSLCVGKSHKWWEKGLQSNMKDITSAQDL 509 +F GTR++++Q + + N Q++ ++M+L +GK+ KWWEKGL NMK+ITSAQDL Sbjct: 39 NFLGTRLVIKQSKAIHQNSNPQAISVQMALSIGKAMKWWEKGLHPNMKEITSAQDL 94 >ref|XP_007161960.1| hypothetical protein PHAVU_001G112200g [Phaseolus vulgaris] gi|561035424|gb|ESW33954.1| hypothetical protein PHAVU_001G112200g [Phaseolus vulgaris] Length = 292 Score = 58.9 bits (141), Expect = 7e-07 Identities = 38/117 (32%), Positives = 57/117 (48%), Gaps = 17/117 (14%) Frame = +3 Query: 210 MAEILSKSNFLSS------------SPCPPHCFFIXXXXXXXXXXXXXXXXXXXN--CDF 347 MAE+ +K++F+SS S P C F+ + +F Sbjct: 1 MAEVFTKASFVSSLLGSSQRHHRRVSTVPDTCTFVSGVGGSPSLKLKSPILRSWSPSSEF 60 Query: 348 NGTRIILQQVERKPRRKNLQ---SLPIKMSLCVGKSHKWWEKGLQSNMKDITSAQDL 509 G +++ + KP R + + S +M+L +GK KWWEKGLQ NMK++TSAQDL Sbjct: 61 QGKQLLFRVNRGKPNRVSSRLRASTAAQMTLRIGKVQKWWEKGLQPNMKEVTSAQDL 117 >ref|XP_006658147.1| PREDICTED: thioredoxin-like 1-1, chloroplastic-like [Oryza brachyantha] Length = 274 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/55 (45%), Positives = 40/55 (72%) Frame = +3 Query: 345 FNGTRIILQQVERKPRRKNLQSLPIKMSLCVGKSHKWWEKGLQSNMKDITSAQDL 509 F G R+ L + + + +NL++ P +M+L +GK+ +WWE+GLQ NM++I SAQDL Sbjct: 45 FPGGRVALTEKKARLLPRNLEAAPGQMNLTIGKAMRWWERGLQPNMREIESAQDL 99 >gb|AFD98846.1| chloroplast Trx [Gossypium hirsutum] Length = 287 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/59 (47%), Positives = 39/59 (66%), Gaps = 3/59 (5%) Frame = +3 Query: 342 DFNGTRIILQQVERKPRRKNLQSLPIKMSL---CVGKSHKWWEKGLQSNMKDITSAQDL 509 DFNG R++ + + RR+ Q +PIK + +G+ KWWEKGLQ NMK++ SAQDL Sbjct: 56 DFNGQRMVFLEKKSMNRRRFCQ-VPIKAQMQSGLIGRIQKWWEKGLQPNMKEVASAQDL 113 >gb|ACN36361.1| unknown [Zea mays] gi|413955845|gb|AFW88494.1| putative thioredoxin superfamily protein [Zea mays] Length = 221 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/57 (45%), Positives = 38/57 (66%), Gaps = 2/57 (3%) Frame = +3 Query: 345 FNGTRIILQQVERKPRRKNLQSLPIKMS--LCVGKSHKWWEKGLQSNMKDITSAQDL 509 F G R+ L +P ++ + P++M+ L +GKS +WWEKGLQ NM++I SAQDL Sbjct: 52 FPGVRLALGTRRSRPASRSFSASPVQMNMNLAIGKSMRWWEKGLQPNMREIESAQDL 108 >ref|NP_001132524.1| putative thioredoxin superfamily protein [Zea mays] gi|194694626|gb|ACF81397.1| unknown [Zea mays] gi|195626254|gb|ACG34957.1| thioredoxin-like 1 [Zea mays] gi|413955844|gb|AFW88493.1| putative thioredoxin superfamily protein [Zea mays] Length = 281 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/57 (45%), Positives = 38/57 (66%), Gaps = 2/57 (3%) Frame = +3 Query: 345 FNGTRIILQQVERKPRRKNLQSLPIKMS--LCVGKSHKWWEKGLQSNMKDITSAQDL 509 F G R+ L +P ++ + P++M+ L +GKS +WWEKGLQ NM++I SAQDL Sbjct: 52 FPGVRLALGTRRSRPASRSFSASPVQMNMNLAIGKSMRWWEKGLQPNMREIESAQDL 108 >ref|XP_007030215.1| Atypical CYS HIS rich thioredoxin 4 [Theobroma cacao] gi|508718820|gb|EOY10717.1| Atypical CYS HIS rich thioredoxin 4 [Theobroma cacao] Length = 294 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/59 (44%), Positives = 39/59 (66%), Gaps = 3/59 (5%) Frame = +3 Query: 342 DFNGTRIILQQVERKPRRKNLQSLPIKMSL---CVGKSHKWWEKGLQSNMKDITSAQDL 509 DFNG ++ + ++ ++ +PIK + +G+S KWWEKGLQ NMK++TSAQDL Sbjct: 56 DFNGKQVCFLE-KKSVNKRGFGQVPIKAQVRTGLIGRSQKWWEKGLQPNMKEVTSAQDL 113 >ref|XP_003624602.1| Thioredoxin-like protein [Medicago truncatula] gi|355499617|gb|AES80820.1| Thioredoxin-like protein [Medicago truncatula] Length = 220 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +3 Query: 342 DFNGTRIILQQVERKPRRKNLQ---SLPIKMSLCVGKSHKWWEKGLQSNMKDITSAQDL 509 +F+G + I + P+R N Q S KM+L VGK KWWEKG Q NM+++TSAQDL Sbjct: 60 EFHGKKAIFRVNRSTPKRVNSQFSVSAAPKMTLRVGKVQKWWEKGHQPNMREVTSAQDL 118 >ref|XP_003624601.1| Thioredoxin-like protein [Medicago truncatula] gi|124365591|gb|ABN09825.1| Thioredoxin domain 2; Thioredoxin fold [Medicago truncatula] gi|355499616|gb|AES80819.1| Thioredoxin-like protein [Medicago truncatula] gi|388494216|gb|AFK35174.1| unknown [Medicago truncatula] Length = 286 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +3 Query: 342 DFNGTRIILQQVERKPRRKNLQ---SLPIKMSLCVGKSHKWWEKGLQSNMKDITSAQDL 509 +F+G + I + P+R N Q S KM+L VGK KWWEKG Q NM+++TSAQDL Sbjct: 60 EFHGKKAIFRVNRSTPKRVNSQFSVSAAPKMTLRVGKVQKWWEKGHQPNMREVTSAQDL 118 >ref|XP_006348023.1| PREDICTED: thioredoxin-like 1-1, chloroplastic-like [Solanum tuberosum] Length = 301 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/58 (44%), Positives = 40/58 (68%), Gaps = 2/58 (3%) Frame = +3 Query: 342 DFNGTRIILQQVERKPRRKNLQSLPI--KMSLCVGKSHKWWEKGLQSNMKDITSAQDL 509 DF G R+++ + K R+N Q + I +MS+ + K+ KWWEKG+Q NMK++ SAQ+L Sbjct: 58 DFYGRRLVINEGVSKFNRRNSQVVDITAQMSIGIRKAQKWWEKGVQPNMKEVNSAQEL 115 >dbj|BAK03063.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 276 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/55 (49%), Positives = 36/55 (65%) Frame = +3 Query: 345 FNGTRIILQQVERKPRRKNLQSLPIKMSLCVGKSHKWWEKGLQSNMKDITSAQDL 509 F G R+ + K +NL S P++M+L KS KWWEKGL+ NM++I SAQDL Sbjct: 51 FLGARLTVGPRRSKLVPRNLVSSPVQMNLAFAKSTKWWEKGLKPNMREIESAQDL 105 >gb|EMT24637.1| Thioredoxin-like protein 1 [Aegilops tauschii] Length = 276 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/55 (49%), Positives = 36/55 (65%) Frame = +3 Query: 345 FNGTRIILQQVERKPRRKNLQSLPIKMSLCVGKSHKWWEKGLQSNMKDITSAQDL 509 F G R+ + K +NL + P++M+L KS KWWEKGLQ NM++I SAQDL Sbjct: 51 FLGARLTVGPRRTKLVPRNLVASPMQMNLAFAKSTKWWEKGLQPNMREIESAQDL 105