BLASTX nr result
ID: Akebia23_contig00025617
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00025617 (564 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOA91950.1| hypothetical protein SETTUDRAFT_87224 [Setosphaer... 79 1e-12 gb|EMD68022.1| hypothetical protein COCSADRAFT_156488 [Bipolaris... 79 1e-12 ref|XP_001932751.1| TATA-box-binding protein [Pyrenophora tritic... 79 1e-12 ref|XP_007588693.1| putative tata-box-binding protein [Neofusico... 77 2e-12 gb|EKG20002.1| TATA-box binding protein [Macrophomina phaseolina... 77 2e-12 ref|XP_003837823.1| similar to transcription initiation factor T... 77 2e-12 ref|XP_001796519.1| hypothetical protein SNOG_06135 [Phaeosphaer... 77 2e-12 gb|EMF11507.1| transcription initiation factor TFIID, TATA bindi... 76 5e-12 gb|EME88782.1| hypothetical protein MYCFIDRAFT_209898 [Pseudocer... 76 5e-12 gb|EME41317.1| TATA-box binding-like protein [Dothistroma septos... 76 5e-12 gb|EMC92888.1| hypothetical protein BAUCODRAFT_76816 [Baudoinia ... 76 5e-12 ref|XP_002143637.1| RNA polymerase I and III transcription facto... 76 5e-12 ref|XP_003854726.1| transcription factor TFIID complex [Zymosept... 76 5e-12 ref|XP_002479956.1| RNA polymerase I and III transcription facto... 76 5e-12 gb|EYE98252.1| TBP-domain-containing protein [Aspergillus ruber ... 76 7e-12 emb|CDM28778.1| TATA-box-binding protein [Penicillium roqueforti] 76 7e-12 sp|Q12731.1|TBP_EMENI RecName: Full=TATA-box-binding protein; Al... 76 7e-12 dbj|GAD94706.1| RNA polymerase I and III transcription factor co... 76 7e-12 gb|EKV05837.1| RNA polymerase I and III transcription factor com... 76 7e-12 ref|XP_001819715.1| TATA-box-binding protein [Aspergillus oryzae... 76 7e-12 >gb|EOA91950.1| hypothetical protein SETTUDRAFT_87224 [Setosphaeria turcica Et28A] Length = 249 Score = 78.6 bits (192), Expect = 1e-12 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -3 Query: 562 RIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 443 RIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS Sbjct: 210 RIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 249 >gb|EMD68022.1| hypothetical protein COCSADRAFT_156488 [Bipolaris sorokiniana ND90Pr] gi|452000886|gb|EMD93346.1| hypothetical protein COCHEDRAFT_1153946 [Bipolaris maydis C5] gi|477590131|gb|ENI07206.1| hypothetical protein COCC4DRAFT_38809 [Bipolaris maydis ATCC 48331] gi|576923425|gb|EUC37543.1| hypothetical protein COCCADRAFT_85362 [Bipolaris zeicola 26-R-13] gi|576932336|gb|EUC45880.1| hypothetical protein COCMIDRAFT_94399 [Bipolaris oryzae ATCC 44560] gi|578493995|gb|EUN31384.1| hypothetical protein COCVIDRAFT_87975 [Bipolaris victoriae FI3] Length = 249 Score = 78.6 bits (192), Expect = 1e-12 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -3 Query: 562 RIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 443 RIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS Sbjct: 210 RIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 249 >ref|XP_001932751.1| TATA-box-binding protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|330941403|ref|XP_003306059.1| hypothetical protein PTT_19076 [Pyrenophora teres f. teres 0-1] gi|187978315|gb|EDU44941.1| TATA-box-binding protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|311316652|gb|EFQ85856.1| hypothetical protein PTT_19076 [Pyrenophora teres f. teres 0-1] Length = 249 Score = 78.6 bits (192), Expect = 1e-12 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -3 Query: 562 RIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 443 RIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS Sbjct: 210 RIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 249 >ref|XP_007588693.1| putative tata-box-binding protein [Neofusicoccum parvum UCRNP2] gi|485916518|gb|EOD43847.1| putative tata-box-binding protein [Neofusicoccum parvum UCRNP2] Length = 250 Score = 77.4 bits (189), Expect = 2e-12 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -3 Query: 562 RIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 443 +IVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS Sbjct: 211 KIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 250 >gb|EKG20002.1| TATA-box binding protein [Macrophomina phaseolina MS6] Length = 250 Score = 77.4 bits (189), Expect = 2e-12 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -3 Query: 562 RIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 443 +IVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS Sbjct: 211 KIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 250 >ref|XP_003837823.1| similar to transcription initiation factor TFIID [Leptosphaeria maculans JN3] gi|312214387|emb|CBX94379.1| similar to transcription initiation factor TFIID [Leptosphaeria maculans JN3] Length = 246 Score = 77.4 bits (189), Expect = 2e-12 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -3 Query: 562 RIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 443 +IVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS Sbjct: 207 KIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 246 >ref|XP_001796519.1| hypothetical protein SNOG_06135 [Phaeosphaeria nodorum SN15] gi|160706937|gb|EAT85966.2| hypothetical protein SNOG_06135 [Phaeosphaeria nodorum SN15] Length = 247 Score = 77.4 bits (189), Expect = 2e-12 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -3 Query: 562 RIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 443 +IVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS Sbjct: 208 KIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 247 >gb|EMF11507.1| transcription initiation factor TFIID, TATA binding protein [Sphaerulina musiva SO2202] Length = 258 Score = 76.3 bits (186), Expect = 5e-12 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -3 Query: 562 RIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 443 +IVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK+ Sbjct: 219 KIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKT 258 >gb|EME88782.1| hypothetical protein MYCFIDRAFT_209898 [Pseudocercospora fijiensis CIRAD86] Length = 260 Score = 76.3 bits (186), Expect = 5e-12 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -3 Query: 562 RIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 443 +IVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK+ Sbjct: 221 KIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKT 260 >gb|EME41317.1| TATA-box binding-like protein [Dothistroma septosporum NZE10] Length = 254 Score = 76.3 bits (186), Expect = 5e-12 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -3 Query: 562 RIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 443 +IVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK+ Sbjct: 215 KIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKT 254 >gb|EMC92888.1| hypothetical protein BAUCODRAFT_76816 [Baudoinia compniacensis UAMH 10762] Length = 240 Score = 76.3 bits (186), Expect = 5e-12 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -3 Query: 562 RIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 443 +IVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK+ Sbjct: 201 KIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKT 240 >ref|XP_002143637.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces marneffei ATCC 18224] gi|212526962|ref|XP_002143638.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces marneffei ATCC 18224] gi|212526964|ref|XP_002143639.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces marneffei ATCC 18224] gi|62956011|gb|AAY23352.1| TATA-binding protein [Talaromyces marneffei] gi|62956013|gb|AAY23353.1| TATA-binding protein [Talaromyces marneffei] gi|210073035|gb|EEA27122.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces marneffei ATCC 18224] gi|210073036|gb|EEA27123.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces marneffei ATCC 18224] gi|210073037|gb|EEA27124.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces marneffei ATCC 18224] Length = 255 Score = 76.3 bits (186), Expect = 5e-12 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -3 Query: 562 RIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 443 +IVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK+ Sbjct: 216 KIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKT 255 >ref|XP_003854726.1| transcription factor TFIID complex [Zymoseptoria tritici IPO323] gi|339474610|gb|EGP89702.1| transcription factor TFIID complex [Zymoseptoria tritici IPO323] Length = 261 Score = 76.3 bits (186), Expect = 5e-12 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -3 Query: 562 RIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 443 +IVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK+ Sbjct: 222 KIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKT 261 >ref|XP_002479956.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces stipitatus ATCC 10500] gi|242782222|ref|XP_002479957.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces stipitatus ATCC 10500] gi|218720103|gb|EED19522.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces stipitatus ATCC 10500] gi|218720104|gb|EED19523.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces stipitatus ATCC 10500] Length = 255 Score = 76.3 bits (186), Expect = 5e-12 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -3 Query: 562 RIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKS 443 +IVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK+ Sbjct: 216 KIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRKT 255 >gb|EYE98252.1| TBP-domain-containing protein [Aspergillus ruber CBS 135680] Length = 137 Score = 75.9 bits (185), Expect = 7e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -3 Query: 562 RIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK 446 +IVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK Sbjct: 98 KIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK 136 >emb|CDM28778.1| TATA-box-binding protein [Penicillium roqueforti] Length = 264 Score = 75.9 bits (185), Expect = 7e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -3 Query: 562 RIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK 446 +IVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK Sbjct: 225 KIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK 263 >sp|Q12731.1|TBP_EMENI RecName: Full=TATA-box-binding protein; AltName: Full=TATA sequence-binding protein; Short=TBP; AltName: Full=TATA-binding factor; AltName: Full=TATA-box factor; AltName: Full=Transcription initiation factor TFIID TBP subunit gi|887878|gb|AAB57874.1| TATA-box binding protein [Aspergillus nidulans] gi|887880|gb|AAB57876.1| TATA-box binding protein [Aspergillus nidulans] Length = 268 Score = 75.9 bits (185), Expect = 7e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -3 Query: 562 RIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK 446 +IVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK Sbjct: 229 KIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK 267 >dbj|GAD94706.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Byssochlamys spectabilis No. 5] Length = 261 Score = 75.9 bits (185), Expect = 7e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -3 Query: 562 RIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK 446 +IVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK Sbjct: 222 KIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK 260 >gb|EKV05837.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Penicillium digitatum PHI26] gi|425780061|gb|EKV18083.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Penicillium digitatum Pd1] Length = 263 Score = 75.9 bits (185), Expect = 7e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -3 Query: 562 RIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK 446 +IVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK Sbjct: 224 KIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK 262 >ref|XP_001819715.1| TATA-box-binding protein [Aspergillus oryzae RIB40] gi|238487092|ref|XP_002374784.1| transcription factor TFIID [Aspergillus flavus NRRL3357] gi|83767574|dbj|BAE57713.1| unnamed protein product [Aspergillus oryzae RIB40] gi|220699663|gb|EED56002.1| transcription factor TFIID [Aspergillus flavus NRRL3357] gi|391867294|gb|EIT76540.1| TATA-box binding protein (TBP), component of TFIID and TFIIIB [Aspergillus oryzae 3.042] Length = 263 Score = 75.9 bits (185), Expect = 7e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -3 Query: 562 RIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK 446 +IVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK Sbjct: 224 KIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSDFRK 262