BLASTX nr result
ID: Akebia23_contig00025214
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00025214 (357 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN61508.1| hypothetical protein VITISV_000627 [Vitis vinifera] 102 1e-21 ref|YP_004222255.1| hypothetical protein BevumaM_p016 [Beta vulg... 89 6e-16 tpg|DAA38268.1| TPA: putative cytochrome C oxidase subunit II fa... 80 4e-13 gb|AFW86920.1| LOW QUALITY PROTEIN: putative cytochrome C oxidas... 80 4e-13 gb|EHK62703.1| hypothetical protein M3S_K12 (mitochondrion) [Sor... 80 4e-13 gb|EHK62687.1| hypothetical protein M3S_E08, partial (mitochondr... 80 4e-13 gb|EHK62683.1| hypothetical protein M3S_J74 (mitochondrion) [Sor... 80 4e-13 >emb|CAN61508.1| hypothetical protein VITISV_000627 [Vitis vinifera] Length = 201 Score = 102 bits (253), Expect(2) = 1e-21 Identities = 51/54 (94%), Positives = 53/54 (98%) Frame = -1 Query: 300 VVREASGLPVISHSRRRETI*TIACQKRGVEVVRPIPRNAPSIGAYGSILVVAG 139 +VREASGLPVISHSRRRET+ TIACQKRGVEVVRPIPRNAPSIGAYGSILVVAG Sbjct: 1 MVREASGLPVISHSRRRETLITIACQKRGVEVVRPIPRNAPSIGAYGSILVVAG 54 Score = 26.6 bits (57), Expect(2) = 1e-21 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 32 VAYNFGPNGR 3 VAYNFGPNGR Sbjct: 55 VAYNFGPNGR 64 >ref|YP_004222255.1| hypothetical protein BevumaM_p016 [Beta vulgaris subsp. maritima] gi|346683133|ref|YP_004842062.1| hypothetical protein BemaM_p014 [Beta macrocarpa] gi|317905693|emb|CBX33235.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439773|emb|CBX33287.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148025|emb|CBJ20690.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500051|emb|CBX24867.1| hypothetical protein [Beta macrocarpa] gi|384939217|emb|CBL52063.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 178 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/51 (82%), Positives = 44/51 (86%), Gaps = 3/51 (5%) Frame = -3 Query: 355 WYRSAPLHEGDLSATKCTG---GSRSIWLTGNLPFPSSRDYINYSMPETGS 212 WYRSAPLHEGDLSATKC S+SIWLTGNLPFPSSRD+ NYSMPETGS Sbjct: 128 WYRSAPLHEGDLSATKCLKVEYSSQSIWLTGNLPFPSSRDFSNYSMPETGS 178 >tpg|DAA38268.1| TPA: putative cytochrome C oxidase subunit II family protein [Zea mays] Length = 354 Score = 79.7 bits (195), Expect = 4e-13 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -3 Query: 355 WYRSAPLHEGDLSATKCTGGSRSIWLTGNLPFPSSRD 245 WYRSAPL+EGDLSATKCTGGSRSIWLTG+LPFPSSRD Sbjct: 318 WYRSAPLNEGDLSATKCTGGSRSIWLTGHLPFPSSRD 354 >gb|AFW86920.1| LOW QUALITY PROTEIN: putative cytochrome C oxidase subunit II family protein [Zea mays] Length = 375 Score = 79.7 bits (195), Expect = 4e-13 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -3 Query: 355 WYRSAPLHEGDLSATKCTGGSRSIWLTGNLPFPSSRD 245 WYRSAPL+EGDLSATKCTGGSRSIWLTG+LPFPSSRD Sbjct: 339 WYRSAPLNEGDLSATKCTGGSRSIWLTGHLPFPSSRD 375 >gb|EHK62703.1| hypothetical protein M3S_K12 (mitochondrion) [Sorghum bicolor] Length = 131 Score = 79.7 bits (195), Expect = 4e-13 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -3 Query: 355 WYRSAPLHEGDLSATKCTGGSRSIWLTGNLPFPSSRD 245 WYRSAPL+EGDLSATKCTGGSRSIWLTG+LPFPSSRD Sbjct: 95 WYRSAPLNEGDLSATKCTGGSRSIWLTGHLPFPSSRD 131 >gb|EHK62687.1| hypothetical protein M3S_E08, partial (mitochondrion) [Sorghum bicolor] Length = 158 Score = 79.7 bits (195), Expect = 4e-13 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -3 Query: 355 WYRSAPLHEGDLSATKCTGGSRSIWLTGNLPFPSSRD 245 WYRSAPL+EGDLSATKCTGGSRSIWLTG+LPFPSSRD Sbjct: 122 WYRSAPLNEGDLSATKCTGGSRSIWLTGHLPFPSSRD 158 >gb|EHK62683.1| hypothetical protein M3S_J74 (mitochondrion) [Sorghum bicolor] Length = 163 Score = 79.7 bits (195), Expect = 4e-13 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -3 Query: 355 WYRSAPLHEGDLSATKCTGGSRSIWLTGNLPFPSSRD 245 WYRSAPL+EGDLSATKCTGGSRSIWLTG+LPFPSSRD Sbjct: 127 WYRSAPLNEGDLSATKCTGGSRSIWLTGHLPFPSSRD 163