BLASTX nr result
ID: Akebia23_contig00025018
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00025018 (342 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON96869.1| putative ferritin ribonucleotide reductase-like p... 56 5e-06 >gb|EON96869.1| putative ferritin ribonucleotide reductase-like protein [Togninia minima UCRPA7] Length = 408 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = +1 Query: 70 QLPPTGQVYVVLSTADGTETKVSNANTISGVGVLEVVA 183 Q PP+GQVYV+LSTADG + N+NT+SGVG+LEV A Sbjct: 331 QAPPSGQVYVLLSTADGVNALIENSNTLSGVGILEVEA 368