BLASTX nr result
ID: Akebia23_contig00024990
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00024990 (335 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC26770.1| hypothetical protein L484_023386 [Morus notabilis] 57 3e-06 ref|XP_007209164.1| hypothetical protein PRUPE_ppa006108mg [Prun... 57 3e-06 ref|XP_006477070.1| PREDICTED: serine/threonine-protein kinase S... 55 8e-06 >gb|EXC26770.1| hypothetical protein L484_023386 [Morus notabilis] Length = 389 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 253 MEERYEPLKELGAGNFGVARLVRDKKT 333 MEERYEPLKELG+GNFGVARLVRDKKT Sbjct: 1 MEERYEPLKELGSGNFGVARLVRDKKT 27 >ref|XP_007209164.1| hypothetical protein PRUPE_ppa006108mg [Prunus persica] gi|462404899|gb|EMJ10363.1| hypothetical protein PRUPE_ppa006108mg [Prunus persica] Length = 427 Score = 56.6 bits (135), Expect = 3e-06 Identities = 31/61 (50%), Positives = 37/61 (60%), Gaps = 13/61 (21%) Frame = +1 Query: 190 ISIYFFDFWG-------------IFYWWGVWVLGMEERYEPLKELGAGNFGVARLVRDKK 330 + +YFF FW F V +GMEERYE +K+LG+GNFGVARLVRDKK Sbjct: 55 LKLYFFSFWVSCLSLSLSAGDILCFISCLVSWVGMEERYEAMKDLGSGNFGVARLVRDKK 114 Query: 331 T 333 T Sbjct: 115 T 115 >ref|XP_006477070.1| PREDICTED: serine/threonine-protein kinase SAPK3-like [Citrus sinensis] Length = 341 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +1 Query: 253 MEERYEPLKELGAGNFGVARLVRDKKT 333 MEERYEPLKELG+GNFGVARLVRDK+T Sbjct: 1 MEERYEPLKELGSGNFGVARLVRDKRT 27