BLASTX nr result
ID: Akebia23_contig00024873
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00024873 (521 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004306889.1| PREDICTED: cytochrome P450 704C1-like [Fraga... 56 5e-06 ref|XP_007219030.1| hypothetical protein PRUPE_ppa004495mg [Prun... 56 5e-06 ref|XP_007217935.1| hypothetical protein PRUPE_ppa004947mg [Prun... 55 8e-06 >ref|XP_004306889.1| PREDICTED: cytochrome P450 704C1-like [Fragaria vesca subsp. vesca] Length = 509 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/49 (53%), Positives = 37/49 (75%) Frame = +3 Query: 375 LKRIGFWEEKIRIFNIEDEGILDLLMRCTLDSIFKVGFGVDLNCLERSS 521 ++++ + E +F+++D LLMRCTLDSIFKVGFG++LNCLE SS Sbjct: 158 VRKVSEFSESSEVFDMQD-----LLMRCTLDSIFKVGFGIELNCLEGSS 201 >ref|XP_007219030.1| hypothetical protein PRUPE_ppa004495mg [Prunus persica] gi|462415492|gb|EMJ20229.1| hypothetical protein PRUPE_ppa004495mg [Prunus persica] Length = 507 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +3 Query: 408 RIFNIEDEGILDLLMRCTLDSIFKVGFGVDLNCLERSS 521 R+F+++D LLMRCTLDSIFKVGFG+DLNCLE SS Sbjct: 166 RVFDMQD-----LLMRCTLDSIFKVGFGIDLNCLEGSS 198 >ref|XP_007217935.1| hypothetical protein PRUPE_ppa004947mg [Prunus persica] gi|462414397|gb|EMJ19134.1| hypothetical protein PRUPE_ppa004947mg [Prunus persica] Length = 484 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +3 Query: 441 DLLMRCTLDSIFKVGFGVDLNCLERSS 521 DLLMRCTLDSIFKVGFG+DLNCLE SS Sbjct: 149 DLLMRCTLDSIFKVGFGIDLNCLEGSS 175