BLASTX nr result
ID: Akebia23_contig00024646
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00024646 (296 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCH50976.1| T4.15 [Malus x robusta] 57 3e-06 >emb|CCH50976.1| T4.15 [Malus x robusta] Length = 986 Score = 57.0 bits (136), Expect = 3e-06 Identities = 34/78 (43%), Positives = 46/78 (58%), Gaps = 1/78 (1%) Frame = +1 Query: 1 GKMYQTARRPVILQGVGCRAIK-KHVYKMSVVEITMLRWTSGKTREKKSKMGNIFGGI*V 177 GK Y+TA RP +L G C A+K +HV+KM V E+ MLRW G TR+ K + +I G + V Sbjct: 843 GKFYRTAIRPAMLYGTECWAVKHQHVHKMGVAEMRMLRWMCGHTRKDKIRNEDIRGKVGV 902 Query: 178 LPN*EIK*RARACWT*WF 231 EI+ + R WF Sbjct: 903 A---EIQGKMRENQLRWF 917