BLASTX nr result
ID: Akebia23_contig00024501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00024501 (615 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006372275.1| hypothetical protein POPTR_0018s14880g [Popu... 56 1e-05 >ref|XP_006372275.1| hypothetical protein POPTR_0018s14880g [Populus trichocarpa] gi|550318806|gb|ERP50072.1| hypothetical protein POPTR_0018s14880g [Populus trichocarpa] Length = 289 Score = 55.8 bits (133), Expect = 1e-05 Identities = 23/40 (57%), Positives = 30/40 (75%) Frame = +1 Query: 4 KENKDISRKENKDHQLPKRSTVWGNLRSFADGFINLWRKM 123 K KDIS +LPK+STVWG+L+SFADG +++WRKM Sbjct: 250 KHEKDISSTHTDGAELPKKSTVWGSLKSFADGLVSMWRKM 289